(data stored in ACNUC7421 zone)

EMBL: CP001658.PE784

CP001658.PE784       Location/Qualifiers
FT   CDS             847357..849111
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00768"
FT                   /product="PE-PGRS family protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00768"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23805"
FT                   /protein_id="ACT23805.1"
FT                   /translation="MSFVIVARDALAAAAADLAQIGSAVNAGNLAAANPTTAVAAAAAD
FT                   EVSAALAALFGAHAREYQAAAAQAAAYHEQFVHRLSAAATSYAVTEVTIATSLRGALGS
FT                   APASVSDGFQAFVYGPIHATGQQWINSPVGEALAPIVNAPTNVLLGRDLIGNGVTGTAA
FT                   APNGGPGGLLFGDGGAGYTGGNGGSAGLIGNGGTGGAGFAGGVGGMGGTGGWLMGNGGM
FT                   GGAGGVGGNGGAGGQALLFGNGGLGGAGGAGGVDGAIGRGGWFIGTGGMATIGGGGNGQ
FT                   SIVIDFVRHGQTPGNAAMLIDTAVPGPGLTALGQQQAQAIANALAAKGPYAGIFDSQLI
FT                   RTQQTAAPLANLLGMAPQVLPGLNEIHAGIFEDLPQISPAGLLYLVGPIAWTLGFPIVP
FT                   MLAPGSTDVNGIVFNRAFTGAVQTIYDASLANPVVAADGNITSVAYSSAFTIGVGTMMN
FT                   VDNPHPLLLLTHPVPNTGAVVVQGNPEGGWTLVSWDGIPVGPASLPTALFVDVRELITA
FT                   PQYAAYDIWESLFTGDPAAVINAVRDGADEVGAAVVQFPHAVADDVIDATGHPYLSGLP
FT                   IGLPSLIP"
     MSFVIVARDA LAAAAADLAQ IGSAVNAGNL AAANPTTAVA AAAADEVSAA LAALFGAHAR        60
     EYQAAAAQAA AYHEQFVHRL SAAATSYAVT EVTIATSLRG ALGSAPASVS DGFQAFVYGP       120
     IHATGQQWIN SPVGEALAPI VNAPTNVLLG RDLIGNGVTG TAAAPNGGPG GLLFGDGGAG       180
     YTGGNGGSAG LIGNGGTGGA GFAGGVGGMG GTGGWLMGNG GMGGAGGVGG NGGAGGQALL       240
     FGNGGLGGAG GAGGVDGAIG RGGWFIGTGG MATIGGGGNG QSIVIDFVRH GQTPGNAAML       300
     IDTAVPGPGL TALGQQQAQA IANALAAKGP YAGIFDSQLI RTQQTAAPLA NLLGMAPQVL       360
     PGLNEIHAGI FEDLPQISPA GLLYLVGPIA WTLGFPIVPM LAPGSTDVNG IVFNRAFTGA       420
     VQTIYDASLA NPVVAADGNI TSVAYSSAFT IGVGTMMNVD NPHPLLLLTH PVPNTGAVVV       480
     QGNPEGGWTL VSWDGIPVGP ASLPTALFVD VRELITAPQY AAYDIWESLF TGDPAAVINA       540
     VRDGADEVGA AVVQFPHAVA DDVIDATGHP YLSGLPIGLP SLIP                        584
//

If you have problems or comments...

PBIL Back to PBIL home page