(data stored in ACNUC7421 zone)

EMBL: CP001658.PE787

CP001658.PE787       Location/Qualifiers
FT   CDS             complement(851939..852664)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00771"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00771"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23808"
FT                   /protein_id="ACT23808.1"
FT                   /translation="MNLGQTLVGIATWPARAGLAAADTGLNMAGAAVDMAKQALGDAGG
FT                   ASGSTSMANMLGIDDTIARANRLARLLDDDMPLGRAIAPNGPMDRMLRPGGVVDLLTQP
FT                   GGLLDRLTAEGGAMQRALQPGGLADQLLAEDGLIERVLSEDGLADRLLAEGGLIDKITA
FT                   KDGPLEQLADVADTLARLTPGMEALEPAIATLQDAVIALTMVVNPLSSIAERIPLPGRR
FT                   PARRSSSRSVRSQRVVDSE"
     MNLGQTLVGI ATWPARAGLA AADTGLNMAG AAVDMAKQAL GDAGGASGST SMANMLGIDD        60
     TIARANRLAR LLDDDMPLGR AIAPNGPMDR MLRPGGVVDL LTQPGGLLDR LTAEGGAMQR       120
     ALQPGGLADQ LLAEDGLIER VLSEDGLADR LLAEGGLIDK ITAKDGPLEQ LADVADTLAR       180
     LTPGMEALEP AIATLQDAVI ALTMVVNPLS SIAERIPLPG RRPARRSSSR SVRSQRVVDS       240
     E                                                                       241
//

If you have problems or comments...

PBIL Back to PBIL home page