(data stored in ACNUC7421 zone)

EMBL: CP001658.PE789

CP001658.PE789       Location/Qualifiers
FT   CDS             853594..855051
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00773"
FT                   /product="two component system sensor kinase phoR"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00773"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23810"
FT                   /protein_id="ACT23810.1"
FT                   /translation="MARHLRGRLPLRVRLVAATLILVATGLVASGIAVTSMLQHRLTSR
FT                   IDRVLLEEAQIWAQITLPLAPDPYPGHNPDRPPSRFYVRVISPDGQSYTALNDNTAIPA
FT                   VPANNDVGRHPTTLPSIGGSKTLWRAVSVRASDGYLTTVAIDLADVRSTVRSLVLLQVG
FT                   IGSAVLVVLGVAGYAVVRRSLRPLAEFEQTAAAIGAGQLDRRVPQWHPRTEVGRLSLAL
FT                   NGMLAQIQRAVASAESSAEKARDSEDRMRQFITDASHELRTPLTTIRGFAELYRQGAAR
FT                   DVGMLLSRIESEASRMGLLVDDLLLLARLDAHRPLELCRVDLLALASDAAHDARAMDPK
FT                   RRITLEVLDGPGTPEVLGDESRLRQVLRNLVANAIQHTPESADVTVRVGTEGDDAILEV
FT                   ADDGPGMSQEDALRVFERFYRADSSRARASGGTGLGLSIVDSLVAAHGGAVTVTTALGE
FT                   GCCFRVSLPRVSDVDQLSLTPVVPGPP"
     MARHLRGRLP LRVRLVAATL ILVATGLVAS GIAVTSMLQH RLTSRIDRVL LEEAQIWAQI        60
     TLPLAPDPYP GHNPDRPPSR FYVRVISPDG QSYTALNDNT AIPAVPANND VGRHPTTLPS       120
     IGGSKTLWRA VSVRASDGYL TTVAIDLADV RSTVRSLVLL QVGIGSAVLV VLGVAGYAVV       180
     RRSLRPLAEF EQTAAAIGAG QLDRRVPQWH PRTEVGRLSL ALNGMLAQIQ RAVASAESSA       240
     EKARDSEDRM RQFITDASHE LRTPLTTIRG FAELYRQGAA RDVGMLLSRI ESEASRMGLL       300
     VDDLLLLARL DAHRPLELCR VDLLALASDA AHDARAMDPK RRITLEVLDG PGTPEVLGDE       360
     SRLRQVLRNL VANAIQHTPE SADVTVRVGT EGDDAILEVA DDGPGMSQED ALRVFERFYR       420
     ADSSRARASG GTGLGLSIVD SLVAAHGGAV TVTTALGEGC CFRVSLPRVS DVDQLSLTPV       480
     VPGPP                                                                   485
//

If you have problems or comments...

PBIL Back to PBIL home page