(data stored in ACNUC7421 zone)

EMBL: CP001658.PE798

CP001658.PE798       Location/Qualifiers
FT   CDS             complement(861295..861909)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00782"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00782"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23819"
FT                   /protein_id="ACT23819.1"
FT                   /translation="MSSDVLVTTPAQRQTEPHAEAVSRNRRQQATFRKVLAAAMATLRE
FT                   KSYADLTVRLVAARAKVAPATAYTYFSSKNHLIAEVYLDLVRQVPCVTDVNVPMPIRVT
FT                   SSLRHLALVVADEPEIGAACTAALLDGGADPAVRAVRDRIGAEIHRRITSAIGPGADPG
FT                   TVFALEMAFFGALVQAGSGHLHLPRDRRSTRVRGGPDLGRS"
     MSSDVLVTTP AQRQTEPHAE AVSRNRRQQA TFRKVLAAAM ATLREKSYAD LTVRLVAARA        60
     KVAPATAYTY FSSKNHLIAE VYLDLVRQVP CVTDVNVPMP IRVTSSLRHL ALVVADEPEI       120
     GAACTAALLD GGADPAVRAV RDRIGAEIHR RITSAIGPGA DPGTVFALEM AFFGALVQAG       180
     SGHLHLPRDR RSTRVRGGPD LGRS                                              204
//

If you have problems or comments...

PBIL Back to PBIL home page