(data stored in ACNUC7421 zone)

EMBL: CP001658.PE805

CP001658.PE805       Location/Qualifiers
FT   CDS             complement(868639..869550)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00789"
FT                   /product="hypothetical exported protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00789"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23826"
FT                   /protein_id="ACT23826.1"
FT                   /translation="MMARMPELSRRAVLGLGAGTVLGATSAYAIDMLLQPRTSHAAPAA
FT                   AIGTNVPLAPTPALDPAPPAQAAPTMSTGSFVSAARAGKMTNWAIARPPGQTQALRPVI
FT                   ALHGLGGSASAVMDGGVEQGLAQAVNAGLPPFAVVSVDGGSSYWHQRASGEDAGAMVLN
FT                   ELIPLLDTQRLDTSRVAFLGWSMGGYGALLLGSRLGPARTAAICAVSPALWLSAGSVAP
FT                   GSFDGPDDWSANSVFGLPALGSIPIRVDCGNSDPFYAATKQFVAQLPHPPAGGFSPGGH
FT                   NGGFWSAQLPAELTWFAPLLTG"
     MMARMPELSR RAVLGLGAGT VLGATSAYAI DMLLQPRTSH AAPAAAIGTN VPLAPTPALD        60
     PAPPAQAAPT MSTGSFVSAA RAGKMTNWAI ARPPGQTQAL RPVIALHGLG GSASAVMDGG       120
     VEQGLAQAVN AGLPPFAVVS VDGGSSYWHQ RASGEDAGAM VLNELIPLLD TQRLDTSRVA       180
     FLGWSMGGYG ALLLGSRLGP ARTAAICAVS PALWLSAGSV APGSFDGPDD WSANSVFGLP       240
     ALGSIPIRVD CGNSDPFYAA TKQFVAQLPH PPAGGFSPGG HNGGFWSAQL PAELTWFAPL       300
     LTG                                                                     303
//

If you have problems or comments...

PBIL Back to PBIL home page