(data stored in ACNUC7421 zone)

EMBL: CP001658.PE816

CP001658.PE816       Location/Qualifiers
FT   CDS             879821..880525
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00799"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00799"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23837"
FT                   /protein_id="ACT23837.1"
FT                   /translation="MSGKLLVSVSGIGESTLADVDAFCAEMDARSVPVSLLVAPRMRDD
FT                   YRLDRDPRTVDWLTGRRAAGDALVLHGYDEAATKRRRGEFAMLRAHEANLRLMAADRVL
FT                   EHLGLRTRLFAAPGWLVSPGVRTALPANGFRLLADLHGITDLVRLTTVRARVLGIGEGF
FT                   LAEPWWCRMVVMSAERIARRGGVVRIAVAARHLRKSGPLQAMLDAVDLAMLQGCTPMVY
FT                   RWRADAAVLDAA"
     MSGKLLVSVS GIGESTLADV DAFCAEMDAR SVPVSLLVAP RMRDDYRLDR DPRTVDWLTG        60
     RRAAGDALVL HGYDEAATKR RRGEFAMLRA HEANLRLMAA DRVLEHLGLR TRLFAAPGWL       120
     VSPGVRTALP ANGFRLLADL HGITDLVRLT TVRARVLGIG EGFLAEPWWC RMVVMSAERI       180
     ARRGGVVRIA VAARHLRKSG PLQAMLDAVD LAMLQGCTPM VYRWRADAAV LDAA             234
//

If you have problems or comments...

PBIL Back to PBIL home page