(data stored in ACNUC7421 zone)

EMBL: CP001658.PE817

CP001658.PE817       Location/Qualifiers
FT   CDS             880541..882241
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00800"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00800"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23838"
FT                   /protein_id="ACT23838.1"
FT                   /translation="MALTCTDMSDAVAGSDAEGLTADAIVVGAGLAGLVAACELADRGL
FT                   RVLILDQENRANVGGQAFWSFGGLFLVNSPEQRRLGIRDSHELALQDWLGTAAFDRPED
FT                   YWPEQWAHAYVDFAAGEKRSWLRARGLKIFPLVGWAERGGYDAQGHGNSVPRFHITWGT
FT                   GPALVDIFVRQLRDRPTVRFAHRHQVDKLIVEGNAVTGVRGTVLEPSDEPRGAPSSRKS
FT                   VGKFEFRASAVIVASGGIGGNHELVRKNWPRRMGRIPKQLLSGVPAHVDGRMIGIAQKA
FT                   GAAVINPDRMWHYTEGITNYDPIWPRHGIRIIPGPSSLWLDAAGKRLPVPLFPGFDTLG
FT                   TLEYITKSGHDYTWFVLNAKIIEKEFALSGQEQNPDLTGRRLGQLLRSRAHAGPPGPVQ
FT                   AFIDRGVDFVHANSLRELVAAMNELPDVVPLDYETVAAAVTARDREVVNKYSKDGQITA
FT                   IRAARRYRGDRFGRVVAPHRLTDPKAGPLIAVKLHILTRKTLGGIETDLDARVLKADGT
FT                   PLAGLYAAGEVAGFGGGGVHGYRALEGTFLGGCIFSGRAAGRGAAEDIR"
     MALTCTDMSD AVAGSDAEGL TADAIVVGAG LAGLVAACEL ADRGLRVLIL DQENRANVGG        60
     QAFWSFGGLF LVNSPEQRRL GIRDSHELAL QDWLGTAAFD RPEDYWPEQW AHAYVDFAAG       120
     EKRSWLRARG LKIFPLVGWA ERGGYDAQGH GNSVPRFHIT WGTGPALVDI FVRQLRDRPT       180
     VRFAHRHQVD KLIVEGNAVT GVRGTVLEPS DEPRGAPSSR KSVGKFEFRA SAVIVASGGI       240
     GGNHELVRKN WPRRMGRIPK QLLSGVPAHV DGRMIGIAQK AGAAVINPDR MWHYTEGITN       300
     YDPIWPRHGI RIIPGPSSLW LDAAGKRLPV PLFPGFDTLG TLEYITKSGH DYTWFVLNAK       360
     IIEKEFALSG QEQNPDLTGR RLGQLLRSRA HAGPPGPVQA FIDRGVDFVH ANSLRELVAA       420
     MNELPDVVPL DYETVAAAVT ARDREVVNKY SKDGQITAIR AARRYRGDRF GRVVAPHRLT       480
     DPKAGPLIAV KLHILTRKTL GGIETDLDAR VLKADGTPLA GLYAAGEVAG FGGGGVHGYR       540
     ALEGTFLGGC IFSGRAAGRG AAEDIR                                            566
//

If you have problems or comments...

PBIL Back to PBIL home page