(data stored in ACNUC7421 zone)

EMBL: CP001658.PE82

CP001658.PE82        Location/Qualifiers
FT   CDS             88335..89156
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00080"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00080"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23103"
FT                   /protein_id="ACT23103.1"
FT                   /translation="MEPKRSRLVVCAPEPSHAREFPDVAVFSGGRANASQAERLARAVG
FT                   RVLADRGVTGGARVRLTMANCADGPTLVQINLQVGDTPLRAQAATAGIDHLRPALIRLD
FT                   RQIVRASAQWCPRPWPDRPRRRLTTPAEALVTRRKPVVLRRATPLQAIAAMDAMDYDVH
FT                   LFTDAETGEDAVVYRAGPSGLRLARQHHVFPPGWSRCRAPAGPPVPLIVNSRPTPVLTE
FT                   AAAVDRAREHGLPFLFFTDQATGRGQLLYSRYDGNLGLITPTGDGVADGLA"
     MEPKRSRLVV CAPEPSHARE FPDVAVFSGG RANASQAERL ARAVGRVLAD RGVTGGARVR        60
     LTMANCADGP TLVQINLQVG DTPLRAQAAT AGIDHLRPAL IRLDRQIVRA SAQWCPRPWP       120
     DRPRRRLTTP AEALVTRRKP VVLRRATPLQ AIAAMDAMDY DVHLFTDAET GEDAVVYRAG       180
     PSGLRLARQH HVFPPGWSRC RAPAGPPVPL IVNSRPTPVL TEAAAVDRAR EHGLPFLFFT       240
     DQATGRGQLL YSRYDGNLGL ITPTGDGVAD GLA                                    273
//

If you have problems or comments...

PBIL Back to PBIL home page