(data stored in ACNUC7421 zone)

EMBL: CP001658.PE820

CP001658.PE820       Location/Qualifiers
FT   CDS             883725..883964
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00803"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00803"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23841"
FT                   /protein_id="ACT23841.1"
FT                   /translation="MARVVVHVMPKAEILDPQGQAIVGALGRLGHLGISDVRQGKRFEL
FT                   EVDDTVDDTTLAEIAESLLANTVIEDWTISRDPQ"
     MARVVVHVMP KAEILDPQGQ AIVGALGRLG HLGISDVRQG KRFELEVDDT VDDTTLAEIA        60
     ESLLANTVIE DWTISRDPQ                                                     79
//

If you have problems or comments...

PBIL Back to PBIL home page