(data stored in ACNUC7421 zone)

EMBL: CP001658.PE822

CP001658.PE822       Location/Qualifiers
FT   CDS             complement(884652..885251)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00805"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00805"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23843"
FT                   /protein_id="ACT23843.1"
FT                   /translation="MSRRAIHSGRAAPRRSGNSHLVLRNRVPSSKDSPRRRPHHEFMTE
FT                   SIGEPLSTNLIERYLRARGRRYFRGHHDAEFFFVANAHLRLHVHLEISPAYRDVFTIRV
FT                   SPAYFFPATDHTRLAEIVNAWNLQNHEVTAIVHGSSDPHRIGVAAERSLIRDRIRFDDF
FT                   ATFVDNAVSAATELFGQLTAAGLPPTATPPLLRDAG"
     MSRRAIHSGR AAPRRSGNSH LVLRNRVPSS KDSPRRRPHH EFMTESIGEP LSTNLIERYL        60
     RARGRRYFRG HHDAEFFFVA NAHLRLHVHL EISPAYRDVF TIRVSPAYFF PATDHTRLAE       120
     IVNAWNLQNH EVTAIVHGSS DPHRIGVAAE RSLIRDRIRF DDFATFVDNA VSAATELFGQ       180
     LTAAGLPPTA TPPLLRDAG                                                    199
//

If you have problems or comments...

PBIL Back to PBIL home page