(data stored in ACNUC7421 zone)

EMBL: CP001658.PE824

CP001658.PE824       Location/Qualifiers
FT   CDS             complement(885998..887041)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00807"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00807"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23845"
FT                   /protein_id="ACT23845.1"
FT                   /translation="MNAKDDPHFGLMLAATVNGLAVGSYREMVVVSQTAEEYGFDSVWL
FT                   CDHFLTISPGEYAKVAGIAADTGSATGTETGGAGQCAPSRSLPLLECWTALAALCRDTT
FT                   KLRLGTSVLCNSYRHPSVLAKMAATLDVISQGRLDLGLGAGWFRRESQAYGIPFPPVGD
FT                   RVSALAESLQVIKAVWTEPNPTYAGRFYTLDGATCDPPPVQRPHPPLWIGGEGDRVQRI
FT                   AAKHAQGLNVRWWSPQQVTQRRGFLTQASEAAGRDPDTLRLSVTLLLAPTQSGEEEVRI
FT                   REEFASIPEPGLIVGTPDRCVERIREYQDRGVGHFLFTIPHVVKSDYLHIIGSDIIPRV
FT                   KTEVTIP"
     MNAKDDPHFG LMLAATVNGL AVGSYREMVV VSQTAEEYGF DSVWLCDHFL TISPGEYAKV        60
     AGIAADTGSA TGTETGGAGQ CAPSRSLPLL ECWTALAALC RDTTKLRLGT SVLCNSYRHP       120
     SVLAKMAATL DVISQGRLDL GLGAGWFRRE SQAYGIPFPP VGDRVSALAE SLQVIKAVWT       180
     EPNPTYAGRF YTLDGATCDP PPVQRPHPPL WIGGEGDRVQ RIAAKHAQGL NVRWWSPQQV       240
     TQRRGFLTQA SEAAGRDPDT LRLSVTLLLA PTQSGEEEVR IREEFASIPE PGLIVGTPDR       300
     CVERIREYQD RGVGHFLFTI PHVVKSDYLH IIGSDIIPRV KTEVTIP                     347
//

If you have problems or comments...

PBIL Back to PBIL home page