(data stored in ACNUC7421 zone)

EMBL: CP001658.PE96

CP001658.PE96        Location/Qualifiers
FT   CDS             complement(102946..103794)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00094"
FT                   /product="conserved membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00094"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23117"
FT                   /protein_id="ACT23117.1"
FT                   /translation="MLAQATTAGSFNHHASTVLQGCRGVPAAMWSEPAGAIRRHCATID
FT                   GMDCEVAREALSARLDGERAPVPSARVDEHLGECSACRAWFTQVASQAGDLRRLAESRP
FT                   VVPPVGRLGIRRAPRRQHSPMTWRRWALLCVGIAQIALGTVQGFGLDVGLTHQHPTGAG
FT                   THLLNESTSWSIALGVIMVGAALWPSAAAGLAGVLTAFVAILTGYVIVDALSGAVSTTR
FT                   ILTHLPVVIGAVLAIMVWRSASGPRPRPDAVAAEPDIVLPDNASRGRRRGHLWPTDGSA
FT                   A"
     MLAQATTAGS FNHHASTVLQ GCRGVPAAMW SEPAGAIRRH CATIDGMDCE VAREALSARL        60
     DGERAPVPSA RVDEHLGECS ACRAWFTQVA SQAGDLRRLA ESRPVVPPVG RLGIRRAPRR       120
     QHSPMTWRRW ALLCVGIAQI ALGTVQGFGL DVGLTHQHPT GAGTHLLNES TSWSIALGVI       180
     MVGAALWPSA AAGLAGVLTA FVAILTGYVI VDALSGAVST TRILTHLPVV IGAVLAIMVW       240
     RSASGPRPRP DAVAAEPDIV LPDNASRGRR RGHLWPTDGS AA                          282
//

If you have problems or comments...

PBIL Back to PBIL home page