(data stored in ACNUC7421 zone)

EMBL: CP001658.PE97

CP001658.PE97        Location/Qualifiers
FT   CDS             complement(103841..104800)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00095"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00095"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23118"
FT                   /protein_id="ACT23118.1"
FT                   /translation="MDVSTRQAAEADLAGKAAQYRPDELARYAQRVMDWLHPDGDLTDT
FT                   ERARKRGITLSNQQYDGMSRLSGYLTPQARATFEAVLAKLAAPGATNPDDHTPVIDTTP
FT                   DAAAIDRDTRSQAQRNHDGLLAGLRALIASGKLGQHNGLPVSIVVTTTLTDLQTGAGKG
FT                   FTGGGTLLPMADVIRMTSHAHHYSPASGRYPQAIFDHGTPLALYHTKRLASPAQRIMLF
FT                   ANDRGCTKPGCDAPAYHSQAHHVTAWTSTGRTDITELTLACGPDNRLAEKGWTTHNNTH
FT                   GHTEWLPPPHLDHGQPRTNTFHHPERFLHNQDDDDKPD"
     MDVSTRQAAE ADLAGKAAQY RPDELARYAQ RVMDWLHPDG DLTDTERARK RGITLSNQQY        60
     DGMSRLSGYL TPQARATFEA VLAKLAAPGA TNPDDHTPVI DTTPDAAAID RDTRSQAQRN       120
     HDGLLAGLRA LIASGKLGQH NGLPVSIVVT TTLTDLQTGA GKGFTGGGTL LPMADVIRMT       180
     SHAHHYSPAS GRYPQAIFDH GTPLALYHTK RLASPAQRIM LFANDRGCTK PGCDAPAYHS       240
     QAHHVTAWTS TGRTDITELT LACGPDNRLA EKGWTTHNNT HGHTEWLPPP HLDHGQPRTN       300
     TFHHPERFLH NQDDDDKPD                                                    319
//

If you have problems or comments...

PBIL Back to PBIL home page