(data stored in ACNUC7421 zone)

EMBL: CP001658.PE98

CP001658.PE98        Location/Qualifiers
FT   CDS             complement(104936..105346)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00096"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00096"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23119"
FT                   /protein_id="ACT23119.1"
FT                   /translation="MRYLPVSTRRIWVNPLCHFSFTVISGALFVSARRYDSNMLANSRE
FT                   ELVEVFDALDAELDRLDEVSFEVLSTPERLRSLERLECLVRRLPAVGHTLINQLDTQAS
FT                   EEELGGTLCCALANRLRITKPEAGRRSAEAKP"
     MRYLPVSTRR IWVNPLCHFS FTVISGALFV SARRYDSNML ANSREELVEV FDALDAELDR        60
     LDEVSFEVLS TPERLRSLER LECLVRRLPA VGHTLINQLD TQASEEELGG TLCCALANRL       120
     RITKPEAGRR SAEAKP                                                       136
//

If you have problems or comments...

PBIL Back to PBIL home page