(data stored in ACNUC7421 zone)

EMBL: CP001658.PE99

CP001658.PE99        Location/Qualifiers
FT   CDS             105455..106846
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00097"
FT                   /product="PPE family protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00097"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23120"
FT                   /protein_id="ACT23120.1"
FT                   /translation="MAIPPEVHSGLLSAGCGPGSLLVAAQQWQELSDQYALACAELGQL
FT                   LGEVQASSWQGTAATQYVAAHGPYLAWLEQTAINSAVTAAQHVAAAAAYCSALAAMPTP
FT                   AELAANHAIHGVLIATNFFGINTVPIALNEADYVRMWLQAADTMAAYQAVADAATVAVP
FT                   STQPAPPIRAPGGDAADTRLDVLSSIGQLIRDILDFIANPYKYFLEFFEQFGFSPAVTV
FT                   VLALVALQLYDFLWYPYYASYGLLLLPFFTPTLSALTALSALIHLLNLPPAGLLPIAAA
FT                   LGPGDQWGANLAVAVTPATAAVPGGSPPTSNPAPAAPSSNSVGSASAAPGISYAVPGLA
FT                   PPGVSSGPKAGTKSPDTAADTLATAGAARPGLARAHRRKRSESGVGIRGYRDEFLDATA
FT                   TVDAATDVPAPANAAGSQGAGTLGFAGTAPTTSGAAAGMVQLSSHSTSTTVPLLPTTWT
FT                   TDAEQ"
     MAIPPEVHSG LLSAGCGPGS LLVAAQQWQE LSDQYALACA ELGQLLGEVQ ASSWQGTAAT        60
     QYVAAHGPYL AWLEQTAINS AVTAAQHVAA AAAYCSALAA MPTPAELAAN HAIHGVLIAT       120
     NFFGINTVPI ALNEADYVRM WLQAADTMAA YQAVADAATV AVPSTQPAPP IRAPGGDAAD       180
     TRLDVLSSIG QLIRDILDFI ANPYKYFLEF FEQFGFSPAV TVVLALVALQ LYDFLWYPYY       240
     ASYGLLLLPF FTPTLSALTA LSALIHLLNL PPAGLLPIAA ALGPGDQWGA NLAVAVTPAT       300
     AAVPGGSPPT SNPAPAAPSS NSVGSASAAP GISYAVPGLA PPGVSSGPKA GTKSPDTAAD       360
     TLATAGAARP GLARAHRRKR SESGVGIRGY RDEFLDATAT VDAATDVPAP ANAAGSQGAG       420
     TLGFAGTAPT TSGAAAGMVQ LSSHSTSTTV PLLPTTWTTD AEQ                         463
//

If you have problems or comments...

PBIL Back to PBIL home page