(data stored in ACNUC7421 zone)

EMBL: CP001700.PE1

CP001700.PE1         Location/Qualifiers
FT   CDS             370..2082
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0001"
FT                   /product="chromosomal replication initiator protein DnaA"
FT                   /note="KEGG: fra:Francci3_0001 chromosomal replication
FT                   initiator protein DnaA; TIGRFAM: chromosomal replication
FT                   initiator protein DnaA; PFAM: Chromosomal replication
FT                   initiator DnaA; Chromosomal replication initiator DnaA
FT                   domain; SMART: Chromosomal replication initiator DnaA
FT                   domain; AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0001"
FT                   /db_xref="EnsemblGenomes-Tr:ACU68956"
FT                   /db_xref="GOA:C7QFL7"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR018312"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C7QFL7"
FT                   /inference="protein motif:TFAM:TIGR00362"
FT                   /protein_id="ACU68956.1"
FT                   /translation="MPARRYHQGRQHRMEPQAVSDPQGYTPVPHPPAAPGDAIALWSHF
FT                   RARVESDSSLTKSEQAFLMIPEARTVIGDTIVLAVPDDFSKNYLEQRLEPMLTTHLAAM
FT                   FGPDIKFSLFVDKIMENTPAPAAAGPVAPPAPVIQQLAPPPAHWTPPPAMQSGAELQVP
FT                   AAFHSDPPAFAPDVPRPGLGGMALPPPRVSEPAPEENDPIAATLSLSTGRPGARSSTPD
FT                   DGAKAQQAKLNEKYVFETFVIGSSNRFAHAAAVAVAEAPAKAYNPLFIYGDSGLGKTHL
FT                   LHAIGHYARNLYPGTRVRYVSTEEFTNDFINAIRDGAGNHLRKRYRDVDILMVDDIQFL
FT                   ENKEGTQEEFFHTFNTLHNASKQIVISSDRPPKQLNTLEDRLRSRFEWGLITDIQPPEL
FT                   ETRIAILRKKAQQEGLNAPPEVLEFIASKISTNIRELEGALIRVTAFASLNRAPVDLSL
FT                   AEDVLKNLMPDAAGPEITVSTIMAQTAMYFGITMEDLCGTSRSRILVTARQIAMYLCRE
FT                   LTDLSLPKIGQAFGGRDHTTVMHADRKIRSLLPERRAIFNQVTELTNRIKQSG"
     MPARRYHQGR QHRMEPQAVS DPQGYTPVPH PPAAPGDAIA LWSHFRARVE SDSSLTKSEQ        60
     AFLMIPEART VIGDTIVLAV PDDFSKNYLE QRLEPMLTTH LAAMFGPDIK FSLFVDKIME       120
     NTPAPAAAGP VAPPAPVIQQ LAPPPAHWTP PPAMQSGAEL QVPAAFHSDP PAFAPDVPRP       180
     GLGGMALPPP RVSEPAPEEN DPIAATLSLS TGRPGARSST PDDGAKAQQA KLNEKYVFET       240
     FVIGSSNRFA HAAAVAVAEA PAKAYNPLFI YGDSGLGKTH LLHAIGHYAR NLYPGTRVRY       300
     VSTEEFTNDF INAIRDGAGN HLRKRYRDVD ILMVDDIQFL ENKEGTQEEF FHTFNTLHNA       360
     SKQIVISSDR PPKQLNTLED RLRSRFEWGL ITDIQPPELE TRIAILRKKA QQEGLNAPPE       420
     VLEFIASKIS TNIRELEGAL IRVTAFASLN RAPVDLSLAE DVLKNLMPDA AGPEITVSTI       480
     MAQTAMYFGI TMEDLCGTSR SRILVTARQI AMYLCRELTD LSLPKIGQAF GGRDHTTVMH       540
     ADRKIRSLLP ERRAIFNQVT ELTNRIKQSG                                        570
//

If you have problems or comments...

PBIL Back to PBIL home page