(data stored in ACNUC7421 zone)

EMBL: CP001700.PE10

CP001700.PE10        Location/Qualifiers
FT   CDS             complement(14277..14699)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0010"
FT                   /product="Curculin domain protein (mannose-binding) lectin"
FT                   /note="PFAM: Curculin domain protein (mannose-binding)
FT                   lectin; SMART: Curculin domain protein (mannose-binding)
FT                   lectin; KEGG: pfl:PFL_2127 putidacin L1"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0010"
FT                   /db_xref="EnsemblGenomes-Tr:ACU68965"
FT                   /db_xref="GOA:C7QFM6"
FT                   /db_xref="InterPro:IPR001480"
FT                   /db_xref="InterPro:IPR036426"
FT                   /db_xref="UniProtKB/TrEMBL:C7QFM6"
FT                   /inference="protein motif:PFAM:PF01453"
FT                   /protein_id="ACU68965.1"
FT                   /translation="MVKRTIGAIAGAAALAAALSVAGTGTALAATGGDHLNKGDTMYAN
FT                   DDIHNPAGTKLVFQPDGNLVEYRYDGHVCWATGTNGRGGTRVTYQNDGNLVMYASTDDS
FT                   RPIWASGTSGDNGLNVNINARGEIWVGYDQLTNACE"
     MVKRTIGAIA GAAALAAALS VAGTGTALAA TGGDHLNKGD TMYANDDIHN PAGTKLVFQP        60
     DGNLVEYRYD GHVCWATGTN GRGGTRVTYQ NDGNLVMYAS TDDSRPIWAS GTSGDNGLNV       120
     NINARGEIWV GYDQLTNACE                                                   140
//

If you have problems or comments...

PBIL Back to PBIL home page