(data stored in ACNUC7421 zone)

EMBL: CP001700.PE100

CP001700.PE100       Location/Qualifiers
FT   CDS             103647..105341
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0100"
FT                   /product="Allophanate hydrolase subunit 2"
FT                   /note="PFAM: Allophanate hydrolase subunit 2; Allophanate
FT                   hydrolase subunit 1; SMART: Allophanate hydrolase subunit
FT                   2; Allophanate hydrolase subunit 1; KEGG: aau:AAur_0053
FT                   UreA carboxylase/allophanate hydrolase domain-containing
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0100"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69055"
FT                   /db_xref="GOA:C7QHB6"
FT                   /db_xref="InterPro:IPR003778"
FT                   /db_xref="InterPro:IPR003833"
FT                   /db_xref="InterPro:IPR029000"
FT                   /db_xref="UniProtKB/TrEMBL:C7QHB6"
FT                   /inference="protein motif:PFAM:PF02626"
FT                   /protein_id="ACU69055.1"
FT                   /translation="MLPAGPFGVLLEFDSLDKVQRCFAWVERWRTARPGVLVDVVPAEQ
FT                   TLMAIATFDDAGQRGLREFVAAVGAVDWADAGTDDDAAPAADAETVELPVTYDGPDLDD
FT                   VTRLTGLAANEIVSLHTEAEFTVAFTGFAPGFAYLTGLPDALRVPRRDAPRTRVPTGAV
FT                   ALGGPYSGVYPRESPGGWQLIGQLAPWAPTLWDETRESPALLRPGTRVRFVDAAGQSAP
FT                   DSSAPAKLTQATAAATEPGLRVVRAGPLTTVQDLGRPGFAHLGVPRSGAVDRTSLKLAN
FT                   RLVGNEEGAAALELTLGGGAVQLEVGRWVAVTGARCEITMTVPAPESALEPAAAREVGP
FT                   DRKSAPAAGPSHRPIVMRTVPGTAFYAPEGAVVEVGPAVAGVRAYLAMAGGVGGFEVLG
FT                   SRSVDLLSGVGGRALGGGARVGVGVPVGLPPDIPGLGMAPVRDVGDPVVVRLVLGPRSE
FT                   WFTDDAVRDLVAARWTVGVESNRTAVRLDGPSLARARDGEPASEPLVVGAVQVPRDGRP
FT                   LLFLADHPVTGGYPVIACAHPADVDAAGQARPGTGIRFRMVGGLASR"
     MLPAGPFGVL LEFDSLDKVQ RCFAWVERWR TARPGVLVDV VPAEQTLMAI ATFDDAGQRG        60
     LREFVAAVGA VDWADAGTDD DAAPAADAET VELPVTYDGP DLDDVTRLTG LAANEIVSLH       120
     TEAEFTVAFT GFAPGFAYLT GLPDALRVPR RDAPRTRVPT GAVALGGPYS GVYPRESPGG       180
     WQLIGQLAPW APTLWDETRE SPALLRPGTR VRFVDAAGQS APDSSAPAKL TQATAAATEP       240
     GLRVVRAGPL TTVQDLGRPG FAHLGVPRSG AVDRTSLKLA NRLVGNEEGA AALELTLGGG       300
     AVQLEVGRWV AVTGARCEIT MTVPAPESAL EPAAAREVGP DRKSAPAAGP SHRPIVMRTV       360
     PGTAFYAPEG AVVEVGPAVA GVRAYLAMAG GVGGFEVLGS RSVDLLSGVG GRALGGGARV       420
     GVGVPVGLPP DIPGLGMAPV RDVGDPVVVR LVLGPRSEWF TDDAVRDLVA ARWTVGVESN       480
     RTAVRLDGPS LARARDGEPA SEPLVVGAVQ VPRDGRPLLF LADHPVTGGY PVIACAHPAD       540
     VDAAGQARPG TGIRFRMVGG LASR                                              564
//

If you have problems or comments...

PBIL Back to PBIL home page