(data stored in ACNUC7421 zone)

EMBL: CP001700.PE101

CP001700.PE101       Location/Qualifiers
FT   CDS             complement(105382..106392)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0101"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: stp:Strop_1435 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0101"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69056"
FT                   /db_xref="UniProtKB/TrEMBL:C7QHB7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU69056.1"
FT                   /translation="MPTQTQPWLRAELIAAPETTPGAQLMIPADGVEFHDDQLVFHHQG
FT                   DIVYVAAQGQLRSITWFARQPNPETARRKAQWPNHGTRWTDEERADLRRHLSTGHSWKT
FT                   ISHAHGRSRSGCQQEAVKQGWLDPETLQPTPELLLEAAAPIPDTAAAPAAPAAPADHAA
FT                   PSTNDSHPLSVAASDSTSATASVAASNSVSDSTSGAASDSTPGAESPAIPMHSPAAPHA
FT                   PTPLIFTGSEAAPTPAHAAATPVSHSAVAQPDRPRIPPRVPRQRTGPTTEPHPGPDPGG
FT                   TSSQDSDPDTGDSPGATPSPGTRFLSRAQSSLARATLGAYMNPPRGQSDPASSPT"
     MPTQTQPWLR AELIAAPETT PGAQLMIPAD GVEFHDDQLV FHHQGDIVYV AAQGQLRSIT        60
     WFARQPNPET ARRKAQWPNH GTRWTDEERA DLRRHLSTGH SWKTISHAHG RSRSGCQQEA       120
     VKQGWLDPET LQPTPELLLE AAAPIPDTAA APAAPAAPAD HAAPSTNDSH PLSVAASDST       180
     SATASVAASN SVSDSTSGAA SDSTPGAESP AIPMHSPAAP HAPTPLIFTG SEAAPTPAHA       240
     AATPVSHSAV AQPDRPRIPP RVPRQRTGPT TEPHPGPDPG GTSSQDSDPD TGDSPGATPS       300
     PGTRFLSRAQ SSLARATLGA YMNPPRGQSD PASSPT                                 336
//

If you have problems or comments...

PBIL Back to PBIL home page