(data stored in ACNUC7421 zone)

EMBL: CP001700.PE102

CP001700.PE102       Location/Qualifiers
FT   CDS             complement(106496..106774)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0102"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: nfa:nfa32830 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0102"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69057"
FT                   /db_xref="GOA:C7QHB8"
FT                   /db_xref="UniProtKB/TrEMBL:C7QHB8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU69057.1"
FT                   /translation="MTTQAPQPPPASQPPRTAADKAQRSRMIGAIVIAVVAIWFILANT
FT                   RKASITFWIVTVTSPMWLTLAGTFLAGMLTSLLLTRTRTRKRQKQPQ"
     MTTQAPQPPP ASQPPRTAAD KAQRSRMIGA IVIAVVAIWF ILANTRKASI TFWIVTVTSP        60
     MWLTLAGTFL AGMLTSLLLT RTRTRKRQKQ PQ                                      92
//

If you have problems or comments...

PBIL Back to PBIL home page