(data stored in ACNUC7421 zone)

EMBL: CP001700.PE103

CP001700.PE103       Location/Qualifiers
FT   CDS             complement(106844..107413)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0103"
FT                   /product="FHA domain containing protein"
FT                   /note="PFAM: Forkhead-associated protein; protein of
FT                   unknown function DUF1707; SMART: Forkhead-associated
FT                   protein; KEGG: sma:SAV_2158 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0103"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69058"
FT                   /db_xref="InterPro:IPR000253"
FT                   /db_xref="InterPro:IPR008984"
FT                   /db_xref="InterPro:IPR012551"
FT                   /db_xref="UniProtKB/TrEMBL:C7QHB9"
FT                   /inference="protein motif:PFAM:PF00498"
FT                   /protein_id="ACU69058.1"
FT                   /translation="MGGPSFGNAGWQPPDFRPSDAERDNAIDALSAGAEAGRLSSDTFS
FT                   HRLDQALAVQSHSELTQLVSDLPIPADQPGFGQRVVNAVSAVAHFRFKVKAAWRGPSLP
FT                   RLSLPGGPQVTLRIGRMPECDLQLFDTTVSRYHAEFRRSQNGWFLVDLGSTNGTRVNGW
FT                   RITAPTAVQPGDEVSFGSVVFSLNGR"
     MGGPSFGNAG WQPPDFRPSD AERDNAIDAL SAGAEAGRLS SDTFSHRLDQ ALAVQSHSEL        60
     TQLVSDLPIP ADQPGFGQRV VNAVSAVAHF RFKVKAAWRG PSLPRLSLPG GPQVTLRIGR       120
     MPECDLQLFD TTVSRYHAEF RRSQNGWFLV DLGSTNGTRV NGWRITAPTA VQPGDEVSFG       180
     SVVFSLNGR                                                               189
//

If you have problems or comments...

PBIL Back to PBIL home page