(data stored in ACNUC7421 zone)

EMBL: CP001700.PE104

CP001700.PE104       Location/Qualifiers
FT   CDS             complement(107482..108756)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0104"
FT                   /product="proteinase inhibitor I4 serpin"
FT                   /note="PFAM: proteinase inhibitor I4 serpin; SMART:
FT                   proteinase inhibitor I4 serpin; KEGG: scl:sce4096 secreted
FT                   serine (or cysteine) proteinase inhibitor, clade B
FT                   (ovalbumin), member"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0104"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69059"
FT                   /db_xref="GOA:C7QHC0"
FT                   /db_xref="InterPro:IPR000215"
FT                   /db_xref="InterPro:IPR023795"
FT                   /db_xref="InterPro:IPR023796"
FT                   /db_xref="InterPro:IPR036186"
FT                   /db_xref="InterPro:IPR042178"
FT                   /db_xref="InterPro:IPR042185"
FT                   /db_xref="UniProtKB/TrEMBL:C7QHC0"
FT                   /inference="protein motif:PFAM:PF00079"
FT                   /protein_id="ACU69059.1"
FT                   /translation="MPRKQIAAITAASLAALTACSSSGSSSSAGGSLVRVNAARATVGQ
FT                   ADLSAASAGVNAFGVDVFHSVADGDEGNVMISPTSLATVLTMLLPGAKGQTEAQMAKAL
FT                   HTTMTADQFADALGALDSATVQRELADKAELQQYDTVWTQKGYDIQPSYLQTLASAFDA
FT                   GVRETDFTNSESARQTINKTVEDQTNGLIKDLFGPGSISPATRLALTDSLYLKAKWADA
FT                   FAKSATSDKPFHLTNGSTANVPTMGKEHSFAYAHGADWQYAELPYQQDHLAMGILLPAS
FT                   GSFDTFRKSLTGDSLATMTASATPSPVDLELPKFTFDTSRDLKSPLESLGMQTVFDPNS
FT                   ADLSGVPAKPESLFVGAVVQKTHVAVDEDGTTAAAASGVTVVAGAAPQQSPPAEMHVDR
FT                   PFLFLIRDTVTGQILFLGQVSDPRG"
     MPRKQIAAIT AASLAALTAC SSSGSSSSAG GSLVRVNAAR ATVGQADLSA ASAGVNAFGV        60
     DVFHSVADGD EGNVMISPTS LATVLTMLLP GAKGQTEAQM AKALHTTMTA DQFADALGAL       120
     DSATVQRELA DKAELQQYDT VWTQKGYDIQ PSYLQTLASA FDAGVRETDF TNSESARQTI       180
     NKTVEDQTNG LIKDLFGPGS ISPATRLALT DSLYLKAKWA DAFAKSATSD KPFHLTNGST       240
     ANVPTMGKEH SFAYAHGADW QYAELPYQQD HLAMGILLPA SGSFDTFRKS LTGDSLATMT       300
     ASATPSPVDL ELPKFTFDTS RDLKSPLESL GMQTVFDPNS ADLSGVPAKP ESLFVGAVVQ       360
     KTHVAVDEDG TTAAAASGVT VVAGAAPQQS PPAEMHVDRP FLFLIRDTVT GQILFLGQVS       420
     DPRG                                                                    424
//

If you have problems or comments...

PBIL Back to PBIL home page