(data stored in ACNUC7421 zone)

EMBL: CP001700.PE105

CP001700.PE105       Location/Qualifiers
FT   CDS             108837..109391
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0105"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rha:RHA1_ro03411 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0105"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69060"
FT                   /db_xref="UniProtKB/TrEMBL:C7QHC1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU69060.1"
FT                   /translation="MNAMTVPPMSSPAMPQNQEQEGPGEAVDIPQQQDAEPRQEEMPAV
FT                   TAAETEPGGGAGETGEPAADGDEGKEPAADAGETSGDRDEKEEKEDKDEKKTAAKPKRK
FT                   SAPRKTAGGSKTLVVLKGGRVQYADTDAVVVVDLDEAASPDTDVHDVLDRLTELRDATE
FT                   SPAKTDAVRALTDLIQEKALG"
     MNAMTVPPMS SPAMPQNQEQ EGPGEAVDIP QQQDAEPRQE EMPAVTAAET EPGGGAGETG        60
     EPAADGDEGK EPAADAGETS GDRDEKEEKE DKDEKKTAAK PKRKSAPRKT AGGSKTLVVL       120
     KGGRVQYADT DAVVVVDLDE AASPDTDVHD VLDRLTELRD ATESPAKTDA VRALTDLIQE       180
     KALG                                                                    184
//

If you have problems or comments...

PBIL Back to PBIL home page