(data stored in ACNUC7421 zone)

EMBL: CP001700.PE106

CP001700.PE106       Location/Qualifiers
FT   CDS             complement(109615..110286)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0106"
FT                   /product="nitroreductase"
FT                   /note="PFAM: nitroreductase; KEGG: fre:Franean1_3917
FT                   nitroreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0106"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69061"
FT                   /db_xref="GOA:C7QHC2"
FT                   /db_xref="InterPro:IPR000415"
FT                   /db_xref="InterPro:IPR029479"
FT                   /db_xref="UniProtKB/TrEMBL:C7QHC2"
FT                   /inference="protein motif:PFAM:PF00881"
FT                   /protein_id="ACU69061.1"
FT                   /translation="MDIYEALYTTRAMRRVKPDPIPESVQARILDAAIRAPSGGNGQNW
FT                   RFLLLDDPEKKKLLGPLYRDALDQLYTTVYAPMLAAIAADPDSPESRQMAKVTKSSRWL
FT                   GENFEQVPLFLFAFVQRDRSGGSIFPAVWNAQLAARAQGVGSALTSILGGFHDQEVKEI
FT                   LGVPAEEKWTQSCCVSFGYPTGRWGVAPRRPAHEVAYRNGWGEPVGFTVDEPLWQPSPE
FT                   S"
     MDIYEALYTT RAMRRVKPDP IPESVQARIL DAAIRAPSGG NGQNWRFLLL DDPEKKKLLG        60
     PLYRDALDQL YTTVYAPMLA AIAADPDSPE SRQMAKVTKS SRWLGENFEQ VPLFLFAFVQ       120
     RDRSGGSIFP AVWNAQLAAR AQGVGSALTS ILGGFHDQEV KEILGVPAEE KWTQSCCVSF       180
     GYPTGRWGVA PRRPAHEVAY RNGWGEPVGF TVDEPLWQPS PES                         223
//

If you have problems or comments...

PBIL Back to PBIL home page