(data stored in ACNUC7421 zone)

EMBL: CP001700.PE107

CP001700.PE107       Location/Qualifiers
FT   CDS             complement(110334..110888)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0107"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sgr:SGR_4289 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0107"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69062"
FT                   /db_xref="GOA:C7QHC3"
FT                   /db_xref="InterPro:IPR031571"
FT                   /db_xref="UniProtKB/TrEMBL:C7QHC3"
FT                   /inference="similar to AA sequence:KEGG:SGR_4289"
FT                   /protein_id="ACU69062.1"
FT                   /translation="MPTATTARPKLAARLSGRRHTSRTRRLRVIGAAGFAGVSMALLTA
FT                   EHSVPPARRPPRFAAESLMSGLVAVPVRFADAGSTGYLRPGDRIDVLAAHDAGPDGPPG
FT                   PPEASSGPIPGLGADPPRGETAVAVDVSVLEIAHSADPGSLTRAAPDDGGLVFLAVDNA
FT                   TAARLARAAVADRLSYALRHG"
     MPTATTARPK LAARLSGRRH TSRTRRLRVI GAAGFAGVSM ALLTAEHSVP PARRPPRFAA        60
     ESLMSGLVAV PVRFADAGST GYLRPGDRID VLAAHDAGPD GPPGPPEASS GPIPGLGADP       120
     PRGETAVAVD VSVLEIAHSA DPGSLTRAAP DDGGLVFLAV DNATAARLAR AAVADRLSYA       180
     LRHG                                                                    184
//

If you have problems or comments...

PBIL Back to PBIL home page