(data stored in ACNUC7421 zone)

EMBL: CP001700.PE108

CP001700.PE108       Location/Qualifiers
FT   CDS             complement(111026..111454)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0108"
FT                   /product="regulatory protein, FmdB family"
FT                   /note="TIGRFAM: regulatory protein, FmdB family; KEGG:
FT                   sco:SCO3187 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0108"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69063"
FT                   /db_xref="InterPro:IPR013429"
FT                   /db_xref="UniProtKB/TrEMBL:C7QHC4"
FT                   /inference="protein motif:TFAM:TIGR02605"
FT                   /protein_id="ACU69063.1"
FT                   /translation="MPTYQYQCKDCGEALEVVQKFTDDALTVCPNCQGDLRKVFSAVGI
FT                   VFKGSGFYRTDSRSSSSSSTPPGSSSNGSSGSGSGSSSDSGSGSGSGSSGSGSSSGSGG
FT                   SSGSGSSGGSSKGGSSSSSSSTSSSSSSSSGSSSSTKS"
     MPTYQYQCKD CGEALEVVQK FTDDALTVCP NCQGDLRKVF SAVGIVFKGS GFYRTDSRSS        60
     SSSSTPPGSS SNGSSGSGSG SSSDSGSGSG SGSSGSGSSS GSGGSSGSGS SGGSSKGGSS       120
     SSSSSTSSSS SSSSGSSSST KS                                                142
//

If you have problems or comments...

PBIL Back to PBIL home page