(data stored in ACNUC7421 zone)

EMBL: CP001700.PE109

CP001700.PE109       Location/Qualifiers
FT   CDS             complement(111609..113939)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0109"
FT                   /product="putative PAS/PAC sensor protein"
FT                   /note="KEGG: tfu:Tfu_0250 PAS containing protein
FT                   phosphatase 2C-like; TIGRFAM: PAS sensor protein; PFAM:
FT                   Stage II sporulation E family protein; PAS fold domain
FT                   protein; GAF domain protein; PAS fold-4 domain protein;
FT                   SMART: protein phosphatase 2C domain protein; GAF domain
FT                   protein; PAS domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0109"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69064"
FT                   /db_xref="GOA:C7QHC5"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036457"
FT                   /db_xref="UniProtKB/TrEMBL:C7QHC5"
FT                   /inference="protein motif:TFAM:TIGR00229"
FT                   /protein_id="ACU69064.1"
FT                   /translation="MRRQPGTGEQLPHARPQPSAELVPANSTQTSAISVLEALPDPVVV
FT                   LNHRGQITGWNPAAEELFGWYGEEVLGRPWTEFVVADGTNGNALSHLDSIGSTVQRGGT
FT                   WEGSFPITTRNGDSLLARVRAAPMMSGGMITGTVVTAIDLFGSDASRDDQQRAAARAAV
FT                   RAAVLSRAGMQLGTSLDTGRTLAALAEILVPAFADTCVVDLLDENGVAQRLVTVHSTDT
FT                   APCPPMRSGTEIHYPARHPCDRALRTGRPVLIQGAPRVKALDQDEECDRKSLLLDAKSL
FT                   IAVPLLAPSGVRGVLAIALTEDADPTPRYDTADLELVEELAARAGLALENAAMFDRQRT
FT                   LALALQKSLLPTDLPLPDGVSIRVGYAPGAASEVSGDLYDVVELSAGRIGVVIGDVQGR
FT                   GAHAAAVMGQLRAALRAYAVLDVQPGQLLSYLDELVRGLNEEILVTCVYAIYDPFTRRC
FT                   ALANAGHPPPLLASAHGTYPMEVPPDVPLGIGPLGPGGGKGAVQFEDHIFSIPPGDVLV
FT                   MYTDGVVERRDQSVDTGVRTLCLAIERVVREPRAICRAALRAAGSEAHDDQAVLAMATS
FT                   TVDLPLSRLALPARPEAAFAARHHTRAVLREWGLSEHAELAELLVSELITNAVRHASGP
FT                   RPTPWSFSDSDQYSDPEPPPMAEDMMELAAVREYADHLGALDEENELDLLAEPGLLDEL
FT                   GMLDGTLAAPGGSRRLDLVLRRGLRALWIEVHDPDVRLPRIRQAAETDEGGRGLYLVDA
FT                   LSARWGARPTDAGKFVWFEIPLF"
     MRRQPGTGEQ LPHARPQPSA ELVPANSTQT SAISVLEALP DPVVVLNHRG QITGWNPAAE        60
     ELFGWYGEEV LGRPWTEFVV ADGTNGNALS HLDSIGSTVQ RGGTWEGSFP ITTRNGDSLL       120
     ARVRAAPMMS GGMITGTVVT AIDLFGSDAS RDDQQRAAAR AAVRAAVLSR AGMQLGTSLD       180
     TGRTLAALAE ILVPAFADTC VVDLLDENGV AQRLVTVHST DTAPCPPMRS GTEIHYPARH       240
     PCDRALRTGR PVLIQGAPRV KALDQDEECD RKSLLLDAKS LIAVPLLAPS GVRGVLAIAL       300
     TEDADPTPRY DTADLELVEE LAARAGLALE NAAMFDRQRT LALALQKSLL PTDLPLPDGV       360
     SIRVGYAPGA ASEVSGDLYD VVELSAGRIG VVIGDVQGRG AHAAAVMGQL RAALRAYAVL       420
     DVQPGQLLSY LDELVRGLNE EILVTCVYAI YDPFTRRCAL ANAGHPPPLL ASAHGTYPME       480
     VPPDVPLGIG PLGPGGGKGA VQFEDHIFSI PPGDVLVMYT DGVVERRDQS VDTGVRTLCL       540
     AIERVVREPR AICRAALRAA GSEAHDDQAV LAMATSTVDL PLSRLALPAR PEAAFAARHH       600
     TRAVLREWGL SEHAELAELL VSELITNAVR HASGPRPTPW SFSDSDQYSD PEPPPMAEDM       660
     MELAAVREYA DHLGALDEEN ELDLLAEPGL LDELGMLDGT LAAPGGSRRL DLVLRRGLRA       720
     LWIEVHDPDV RLPRIRQAAE TDEGGRGLYL VDALSARWGA RPTDAGKFVW FEIPLF           776
//

If you have problems or comments...

PBIL Back to PBIL home page