(data stored in ACNUC7421 zone)

EMBL: CP001700.PE11

CP001700.PE11        Location/Qualifiers
FT   CDS             complement(14928..15650)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0011"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="PFAM: UbiC transcription regulator-associated domain
FT                   protein; regulatory protein GntR HTH; SMART: regulatory
FT                   protein GntR HTH; KEGG: saq:Sare_0152 GntR family
FT                   transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0011"
FT                   /db_xref="EnsemblGenomes-Tr:ACU68966"
FT                   /db_xref="GOA:C7QFM7"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR011663"
FT                   /db_xref="InterPro:IPR028978"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C7QFM7"
FT                   /inference="protein motif:PFAM:PF07702"
FT                   /protein_id="ACU68966.1"
FT                   /translation="MKRVDDRPQHARIAADLRAKILAGDITGTLPPFKRLMELYSTTTN
FT                   TAQRAVALLKAEGFVEGQRGKALIIRADRIRIVDAASQFEPPASTITYQILHIGPARPP
FT                   ADAAQKLGLAEGETALLRKRLMLRDEEPVEIEWSFYPESVVTGTALDKPLPQRDLATAP
FT                   TVLAALGWKQAGLVDEIQVREPTTEELQTLELPDEIPVMRTLRTITDAEGTVLEVTVMI
FT                   TSGHLYGVRYQQKLTPPA"
     MKRVDDRPQH ARIAADLRAK ILAGDITGTL PPFKRLMELY STTTNTAQRA VALLKAEGFV        60
     EGQRGKALII RADRIRIVDA ASQFEPPAST ITYQILHIGP ARPPADAAQK LGLAEGETAL       120
     LRKRLMLRDE EPVEIEWSFY PESVVTGTAL DKPLPQRDLA TAPTVLAALG WKQAGLVDEI       180
     QVREPTTEEL QTLELPDEIP VMRTLRTITD AEGTVLEVTV MITSGHLYGV RYQQKLTPPA       240
//

If you have problems or comments...

PBIL Back to PBIL home page