(data stored in ACNUC7421 zone)

EMBL: CP001700.PE110

CP001700.PE110       Location/Qualifiers
FT   CDS             complement(114008..114655)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0110"
FT                   /product="5-formyltetrahydrofolate cyclo-ligase"
FT                   /note="TIGRFAM: 5-formyltetrahydrofolate cyclo-ligase;
FT                   PFAM: 5-formyltetrahydrofolate cyclo-ligase; KEGG:
FT                   sco:SCO3183 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0110"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69065"
FT                   /db_xref="GOA:C7QHC6"
FT                   /db_xref="InterPro:IPR002698"
FT                   /db_xref="InterPro:IPR024185"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:C7QHC6"
FT                   /inference="protein motif:TFAM:TIGR02727"
FT                   /protein_id="ACU69065.1"
FT                   /translation="MTNQFNEPGLAKGTIRSRLLAARRAYAPELRAAWAATACEVLVGQ
FT                   MSGADVVAAYASFGTEPDTGPLLAELRGRGIRVLLPILENDMDLSWGRYSGPDSLVRRI
FT                   PPGGSAPGPIPEPAESLGLDAVLSASWIVVPALAVSPAGIRMGRGGGSYDRVLTRIEAS
FT                   PRGARPRVAALLYPGELGVDIPVEPHDRAVDMAVAGESVRHWDESPGGVLSR"
     MTNQFNEPGL AKGTIRSRLL AARRAYAPEL RAAWAATACE VLVGQMSGAD VVAAYASFGT        60
     EPDTGPLLAE LRGRGIRVLL PILENDMDLS WGRYSGPDSL VRRIPPGGSA PGPIPEPAES       120
     LGLDAVLSAS WIVVPALAVS PAGIRMGRGG GSYDRVLTRI EASPRGARPR VAALLYPGEL       180
     GVDIPVEPHD RAVDMAVAGE SVRHWDESPG GVLSR                                  215
//

If you have problems or comments...

PBIL Back to PBIL home page