(data stored in ACNUC7421 zone)

EMBL: CP001700.PE111

CP001700.PE111       Location/Qualifiers
FT   CDS             114697..115383
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0111"
FT                   /product="diguanylate cyclase"
FT                   /note="KEGG: ace:Acel_0165 diguanylate cyclase with GAF
FT                   sensor; TIGRFAM: diguanylate cyclase; PFAM: GGDEF domain
FT                   containing protein; SMART: GGDEF domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0111"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69066"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:C7QHC7"
FT                   /inference="protein motif:TFAM:TIGR00254"
FT                   /protein_id="ACU69066.1"
FT                   /translation="MSLTAVVLVLLAAAAVALAGMNLALRRRLEHLEETTRTALAQAAS
FT                   EVTGLEQGREDLERLSALDPLTGVWNYRYLQGALGRELEAARATGIGGALLMIDVDDFR
FT                   RVNAGYGHQRGSAVLRELAQRLALEVRHADTFARYGGEEFVLILPGTNADTAAKVAERL
FT                   CYAVRKLTFDAGPDTDSEQGPFQLTISVGGVIFPDHGTHAATLLRVADEQLMAAKRDSH
FT                   GSWRIT"
     MSLTAVVLVL LAAAAVALAG MNLALRRRLE HLEETTRTAL AQAASEVTGL EQGREDLERL        60
     SALDPLTGVW NYRYLQGALG RELEAARATG IGGALLMIDV DDFRRVNAGY GHQRGSAVLR       120
     ELAQRLALEV RHADTFARYG GEEFVLILPG TNADTAAKVA ERLCYAVRKL TFDAGPDTDS       180
     EQGPFQLTIS VGGVIFPDHG THAATLLRVA DEQLMAAKRD SHGSWRIT                    228
//

If you have problems or comments...

PBIL Back to PBIL home page