(data stored in ACNUC7421 zone)

EMBL: CP001700.PE112

CP001700.PE112       Location/Qualifiers
FT   CDS             115398..116318
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0112"
FT                   /product="UTP-glucose-1-phosphate uridylyltransferase"
FT                   /note="TIGRFAM: UTP-glucose-1-phosphate
FT                   uridylyltransferase; PFAM: Nucleotidyl transferase; KEGG:
FT                   sma:SAV_3673 UTP:glucose-1-phosphate uridylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0112"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69067"
FT                   /db_xref="GOA:C7QHC8"
FT                   /db_xref="InterPro:IPR005771"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:C7QHC8"
FT                   /inference="protein motif:TFAM:TIGR01099"
FT                   /protein_id="ACU69067.1"
FT                   /translation="MVEVRKAVIPSAGLGTRFLPATKATPKEMLPVIDKPTIQYVVEEA
FT                   VTAGLTDILMVTGRNKRPLEDHFDRAAELEEALEAKGDKVRLQQVRASAEMANVHYVRQ
FT                   GDPKGLGHAVLKAESYVHGEPFAVLLGDDFIDERDPLLPAMIAVRQRYGGSVVGLIEVP
FT                   EEQIHMYGCAAVKPAVDGPDLGHDHTSLIQITDLVEKPSVAQAPSNLAVIGRYVLDPAV
FT                   MGVLRETAPGRGGEIQLTDALRTLAGDPDIGGPVHGVVFTGRRYDTGNPIDYLKTVVQL
FT                   AVDRPDLGGEFRDWLSSYVRAGFHD"
     MVEVRKAVIP SAGLGTRFLP ATKATPKEML PVIDKPTIQY VVEEAVTAGL TDILMVTGRN        60
     KRPLEDHFDR AAELEEALEA KGDKVRLQQV RASAEMANVH YVRQGDPKGL GHAVLKAESY       120
     VHGEPFAVLL GDDFIDERDP LLPAMIAVRQ RYGGSVVGLI EVPEEQIHMY GCAAVKPAVD       180
     GPDLGHDHTS LIQITDLVEK PSVAQAPSNL AVIGRYVLDP AVMGVLRETA PGRGGEIQLT       240
     DALRTLAGDP DIGGPVHGVV FTGRRYDTGN PIDYLKTVVQ LAVDRPDLGG EFRDWLSSYV       300
     RAGFHD                                                                  306
//

If you have problems or comments...

PBIL Back to PBIL home page