(data stored in ACNUC7421 zone)

EMBL: CP001700.PE113

CP001700.PE113       Location/Qualifiers
FT   CDS             116350..117591
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0113"
FT                   /product="molybdenum cofactor synthesis domain protein"
FT                   /note="TIGRFAM: molybdenum cofactor synthesis domain
FT                   protein; PFAM: MoeA domain protein domain I and II; MoeA
FT                   domain protein domain IV; molybdopterin binding domain;
FT                   KEGG: ace:Acel_0167 molybdopterin molybdochelatase"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0113"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69068"
FT                   /db_xref="GOA:C7QHC9"
FT                   /db_xref="InterPro:IPR001453"
FT                   /db_xref="InterPro:IPR005110"
FT                   /db_xref="InterPro:IPR005111"
FT                   /db_xref="InterPro:IPR036135"
FT                   /db_xref="InterPro:IPR036425"
FT                   /db_xref="InterPro:IPR036688"
FT                   /db_xref="InterPro:IPR038987"
FT                   /db_xref="UniProtKB/TrEMBL:C7QHC9"
FT                   /inference="protein motif:TFAM:TIGR00177"
FT                   /protein_id="ACU69068.1"
FT                   /translation="MSDSENARMRSVDDHLKTVLDTVQLLAPMELPITDVNGLVLAEDV
FT                   VSAISLPPFDNSSVDGYAVRLADLEGAAEDSPAELRVLGDVAAGSVHEGILEPGTCLRI
FT                   MTGAMVPHGAEAVVPVEWTDGGTESVRITRVPERDEHIRVLGSDVAAGDVVLKAGTRLG
FT                   PRQIGLLAAIGQVHAPVHPHPRVVVLSTGSELVEPGTPLGPGQINDGNGPALTAAVNAM
FT                   GATGIRVGIIGDDPQGVLDAIEDQLIRADMVVTTGGVSVGAYDVVKEVLSTLGTVEFTK
FT                   VAMQPGMPQGFGTVGEDRIPIFTLPGNPVSAYVSFEIYIRPAIEKMMGIETGPRETVTA
FT                   TCFGAFTSPSGKRQFARGIYDPHGLSVRPVGGHGSHLVGDLALANALIVVPEYVTEVVD
FT                   GDDVEVIVMEGGPR"
     MSDSENARMR SVDDHLKTVL DTVQLLAPME LPITDVNGLV LAEDVVSAIS LPPFDNSSVD        60
     GYAVRLADLE GAAEDSPAEL RVLGDVAAGS VHEGILEPGT CLRIMTGAMV PHGAEAVVPV       120
     EWTDGGTESV RITRVPERDE HIRVLGSDVA AGDVVLKAGT RLGPRQIGLL AAIGQVHAPV       180
     HPHPRVVVLS TGSELVEPGT PLGPGQINDG NGPALTAAVN AMGATGIRVG IIGDDPQGVL       240
     DAIEDQLIRA DMVVTTGGVS VGAYDVVKEV LSTLGTVEFT KVAMQPGMPQ GFGTVGEDRI       300
     PIFTLPGNPV SAYVSFEIYI RPAIEKMMGI ETGPRETVTA TCFGAFTSPS GKRQFARGIY       360
     DPHGLSVRPV GGHGSHLVGD LALANALIVV PEYVTEVVDG DDVEVIVMEG GPR              413
//

If you have problems or comments...

PBIL Back to PBIL home page