(data stored in ACNUC7421 zone)

EMBL: CP001700.PE114

CP001700.PE114       Location/Qualifiers
FT   CDS             117588..118124
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0114"
FT                   /product="molybdenum cofactor biosynthesis protein C"
FT                   /note="TIGRFAM: molybdenum cofactor biosynthesis protein C;
FT                   PFAM: molybdopterin cofactor biosynthesis MoaC region;
FT                   KEGG: sma:SAV_3671 molybdenum cofactor biosynthesis protein
FT                   C"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0114"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69069"
FT                   /db_xref="GOA:C7QHD0"
FT                   /db_xref="InterPro:IPR002820"
FT                   /db_xref="InterPro:IPR023045"
FT                   /db_xref="InterPro:IPR036522"
FT                   /db_xref="UniProtKB/TrEMBL:C7QHD0"
FT                   /inference="protein motif:TFAM:TIGR00581"
FT                   /protein_id="ACU69069.1"
FT                   /translation="MSSETSGTVETSGVAEAPGGKSDRLTHIDSTGDARMVDVTAKPVS
FT                   ARQARATGFVEVSPKVVELLRGEGMPKGDALSVARIAGIMGAKKTPDLVPLCHPIAISG
FT                   VKVALEVEDSGVAIAATVKTADRTGVEMEALTAVAVAGLTVIDMVKAVDPAAVLTRVQV
FT                   EAKSGGVSGDWSREG"
     MSSETSGTVE TSGVAEAPGG KSDRLTHIDS TGDARMVDVT AKPVSARQAR ATGFVEVSPK        60
     VVELLRGEGM PKGDALSVAR IAGIMGAKKT PDLVPLCHPI AISGVKVALE VEDSGVAIAA       120
     TVKTADRTGV EMEALTAVAV AGLTVIDMVK AVDPAAVLTR VQVEAKSGGV SGDWSREG         178
//

If you have problems or comments...

PBIL Back to PBIL home page