(data stored in ACNUC7421 zone)

EMBL: CP001700.PE115

CP001700.PE115       Location/Qualifiers
FT   CDS             118256..119920
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0115"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   rha:RHA1_ro10371 major facilitator superfamily multidrug
FT                   resistance protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0115"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69070"
FT                   /db_xref="GOA:C7QHD1"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C7QHD1"
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /protein_id="ACU69070.1"
FT                   /translation="MTDTSTAAAPPPENDTGRLDGASRARIFSVIVVVVLFAEVAPLQY
FT                   TMVSPAAQLIGRSFPGVGSNIAWMTIIFGLVGGAATPILGKLSDLYGKRNMLLAVGISF
FT                   LIGSLICATTSNWTMFLIGRAFQAVAIAAATVAYGLIRDLIPRKYVPLAIGLVSTGLGV
FT                   SGVGGIMLSGVLTDTAGWSYKALFWFLVIYTLVTLPLLFLVCPETKFRARQKLDPFGAL
FT                   LLAGGVGFALLYVSNGANVGWSDPLYLGYLLLGVVLMAGFVLLERRVSQPIIDLRLLFS
FT                   PKVSVVLFIAFFAAIVVGIQAFSIPYMVSTPSHDGLIAMTQQGAAARFKGLVQPNQIPV
FT                   KVLGDIGYGLGFTLLGLAFHVQVWGSSVSMFSGAASGQLSGKIGARKPLLIGMLTFAAT
FT                   SGIYAAAHHGALTLALVGIVFGVGFGAYYATTPNLLVEASPPEQQGITAGMLGVSNSIG
FT                   TAVGTAIAAAFQAAHPVRLIVAGQTVLAGTPDPKTGVTERAGVFTDTAYTQIFIACAIA
FT                   GFIALAATFFMRSGRTASTGGLGYLTDPAPAKETAPA"
     MTDTSTAAAP PPENDTGRLD GASRARIFSV IVVVVLFAEV APLQYTMVSP AAQLIGRSFP        60
     GVGSNIAWMT IIFGLVGGAA TPILGKLSDL YGKRNMLLAV GISFLIGSLI CATTSNWTMF       120
     LIGRAFQAVA IAAATVAYGL IRDLIPRKYV PLAIGLVSTG LGVSGVGGIM LSGVLTDTAG       180
     WSYKALFWFL VIYTLVTLPL LFLVCPETKF RARQKLDPFG ALLLAGGVGF ALLYVSNGAN       240
     VGWSDPLYLG YLLLGVVLMA GFVLLERRVS QPIIDLRLLF SPKVSVVLFI AFFAAIVVGI       300
     QAFSIPYMVS TPSHDGLIAM TQQGAAARFK GLVQPNQIPV KVLGDIGYGL GFTLLGLAFH       360
     VQVWGSSVSM FSGAASGQLS GKIGARKPLL IGMLTFAATS GIYAAAHHGA LTLALVGIVF       420
     GVGFGAYYAT TPNLLVEASP PEQQGITAGM LGVSNSIGTA VGTAIAAAFQ AAHPVRLIVA       480
     GQTVLAGTPD PKTGVTERAG VFTDTAYTQI FIACAIAGFI ALAATFFMRS GRTASTGGLG       540
     YLTDPAPAKE TAPA                                                         554
//

If you have problems or comments...

PBIL Back to PBIL home page