(data stored in ACNUC7421 zone)

EMBL: CP001700.PE116

CP001700.PE116       Location/Qualifiers
FT   CDS             complement(119946..121391)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0116"
FT                   /product="Rieske (2Fe-2S) domain protein"
FT                   /note="PFAM: Rieske [2Fe-2S] domain protein; KEGG:
FT                   mxa:MXAN_3480 iron-sulfur cluster-binding protein, Rieske
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0116"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69071"
FT                   /db_xref="GOA:C7QHD2"
FT                   /db_xref="InterPro:IPR017941"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="InterPro:IPR036922"
FT                   /db_xref="UniProtKB/TrEMBL:C7QHD2"
FT                   /inference="protein motif:PFAM:PF00355"
FT                   /protein_id="ACU69071.1"
FT                   /translation="MRGPLMSSTGHAGLRVETPDLRLLCDPWVSPGGAFLGSRFPFPDN
FT                   SHLRAVPRLLEAEWVAVSSAQADHMDVEFLSGLDESVRVVIPAYPSSVLHDRLSAAGVK
FT                   NIVEVEGWQRVPLTDRGDWLTVVPEQSPMAHRAAFLVVADGVSVLHCNDARLSLSQTRR
FT                   AMIEVGGPLDLLALDASEERFRAVKRLVRAVKPRLVMPYGGPGCFLDPELMEHNAVVAP
FT                   GELPAETLTLLPGDSVRITPTSYECVRDPHWEGFAYSDSVAVANHLETYAASRAQEIAD
FT                   VWEAYPDPDAGSGLEDRFAEHFVRLGRMSPYFLERIAMTVRFKVAGADGGVWDVHLGTT
FT                   DETAQYTFRVEARWLEAVLGGEIRWEDLLLSRRIHVEHAPEADGSYLFGLLMHADADAL
FT                   QAIEDYDKRDPDSTVTLTSGDRTFEVTRYCPHSGEDLAEGAVIDEAPEGLVLRCLAHNF
FT                   DFSLTTGLCLNARCEPIVVAAPV"
     MRGPLMSSTG HAGLRVETPD LRLLCDPWVS PGGAFLGSRF PFPDNSHLRA VPRLLEAEWV        60
     AVSSAQADHM DVEFLSGLDE SVRVVIPAYP SSVLHDRLSA AGVKNIVEVE GWQRVPLTDR       120
     GDWLTVVPEQ SPMAHRAAFL VVADGVSVLH CNDARLSLSQ TRRAMIEVGG PLDLLALDAS       180
     EERFRAVKRL VRAVKPRLVM PYGGPGCFLD PELMEHNAVV APGELPAETL TLLPGDSVRI       240
     TPTSYECVRD PHWEGFAYSD SVAVANHLET YAASRAQEIA DVWEAYPDPD AGSGLEDRFA       300
     EHFVRLGRMS PYFLERIAMT VRFKVAGADG GVWDVHLGTT DETAQYTFRV EARWLEAVLG       360
     GEIRWEDLLL SRRIHVEHAP EADGSYLFGL LMHADADALQ AIEDYDKRDP DSTVTLTSGD       420
     RTFEVTRYCP HSGEDLAEGA VIDEAPEGLV LRCLAHNFDF SLTTGLCLNA RCEPIVVAAP       480
     V                                                                       481
//

If you have problems or comments...

PBIL Back to PBIL home page