(data stored in ACNUC7421 zone)

EMBL: CP001700.PE117

CP001700.PE117       Location/Qualifiers
FT   CDS             complement(121480..122364)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0117"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: tfu:Tfu_0410 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0117"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69072"
FT                   /db_xref="InterPro:IPR013830"
FT                   /db_xref="InterPro:IPR036514"
FT                   /db_xref="UniProtKB/TrEMBL:C7QHD3"
FT                   /inference="similar to AA sequence:KEGG:Tfu_0410"
FT                   /protein_id="ACU69072.1"
FT                   /translation="MHVPKLGLRKAAALAAAALCGLAVSAGPASASDGWKHQPYDYYLA
FT                   LGDSLGAGWQPNAVTGQGYISGHGYADDIAASLKLQGGKYVNLACPGETTGSMIHGGCP
FT                   YPEPYKNQLDAAASFLKAHKGDRVLVTLDIGANDVDGCASATGLDIQCGLTGIQQTSQD
FT                   LPVILRTLRAAAGHKTEFVGSTYYNPFLASWLTGSAGQSNAKLSAAFLNLFNAVFAIEY
FT                   PLNGVRVADVSAAFSSNDFVHQVTLQPGVTVPLNVARICQWTWMCAPAPVGPNIHANDA
FT                   GYTVMAKAFEAVI"
     MHVPKLGLRK AAALAAAALC GLAVSAGPAS ASDGWKHQPY DYYLALGDSL GAGWQPNAVT        60
     GQGYISGHGY ADDIAASLKL QGGKYVNLAC PGETTGSMIH GGCPYPEPYK NQLDAAASFL       120
     KAHKGDRVLV TLDIGANDVD GCASATGLDI QCGLTGIQQT SQDLPVILRT LRAAAGHKTE       180
     FVGSTYYNPF LASWLTGSAG QSNAKLSAAF LNLFNAVFAI EYPLNGVRVA DVSAAFSSND       240
     FVHQVTLQPG VTVPLNVARI CQWTWMCAPA PVGPNIHAND AGYTVMAKAF EAVI             294
//

If you have problems or comments...

PBIL Back to PBIL home page