(data stored in ACNUC7421 zone)

EMBL: CP001700.PE118

CP001700.PE118       Location/Qualifiers
FT   CDS             complement(122637..123221)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0118"
FT                   /product="transcriptional regulator, MarR family"
FT                   /note="PFAM: regulatory protein MarR; SMART: regulatory
FT                   protein MarR; KEGG: sco:SCO3133 MarR family regulatory
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0118"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69073"
FT                   /db_xref="GOA:C7QHD4"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR023187"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C7QHD4"
FT                   /inference="protein motif:PFAM:PF01047"
FT                   /protein_id="ACU69073.1"
FT                   /translation="METPHTQGLDAATPADNGAPAPAAPAASDPQACRDEVDRLVEAWR
FT                   HERPDLDVAPLEVLSRVSRLARHLDRARRTAFAEHDLEPWEFDVLSALRRAGAPYQLTP
FT                   SKLLTQTLVTSGTMTNRIDRLAAKDLVKRLPDPGDRRGVLVQLSDTGRERVDGAFEGLL
FT                   AQERELLGGLSAGDRTTLAALLRTLVLPFDN"
     METPHTQGLD AATPADNGAP APAAPAASDP QACRDEVDRL VEAWRHERPD LDVAPLEVLS        60
     RVSRLARHLD RARRTAFAEH DLEPWEFDVL SALRRAGAPY QLTPSKLLTQ TLVTSGTMTN       120
     RIDRLAAKDL VKRLPDPGDR RGVLVQLSDT GRERVDGAFE GLLAQERELL GGLSAGDRTT       180
     LAALLRTLVL PFDN                                                         194
//

If you have problems or comments...

PBIL Back to PBIL home page