(data stored in ACNUC7421 zone)

EMBL: CP001700.PE119

CP001700.PE119       Location/Qualifiers
FT   CDS             123390..124196
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0119"
FT                   /product="Trans-aconitate 2-methyltransferase"
FT                   /EC_number="2.1.1.144"
FT                   /note="PFAM: Methyltransferase type 11; Methyltransferase
FT                   type 12; KEGG: sco:SCO3132 trans-aconitate
FT                   methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0119"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69074"
FT                   /db_xref="GOA:C7QHD5"
FT                   /db_xref="InterPro:IPR023149"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR041698"
FT                   /db_xref="UniProtKB/TrEMBL:C7QHD5"
FT                   /inference="protein motif:PRIAM:2.1.1.144"
FT                   /protein_id="ACU69074.1"
FT                   /translation="MADDIWNAQQYLRFENDRLRPFLDLVTQLDADGDVHTVVDLGCGP
FT                   GNGTALLVDWWPGARIVGVDSSPAMIEAAQEQAIPGQVEFELGDLRQWRADGKVDVLLA
FT                   NAVLQWVPDHLDLLPDLAAQLAPGGVLGFQVPGNFEAPSHLALAEMKRRWAGRVPDDLQ
FT                   KPASHDPAVYLEKLAESGLEPDVWETTYTYLVPADPDPSVPCGVTEFVRGSALRPAIKA
FT                   LSESDAADFVSEYDTLARAAYPVRELGGHSVQLLPYRRIFAIGRTV"
     MADDIWNAQQ YLRFENDRLR PFLDLVTQLD ADGDVHTVVD LGCGPGNGTA LLVDWWPGAR        60
     IVGVDSSPAM IEAAQEQAIP GQVEFELGDL RQWRADGKVD VLLANAVLQW VPDHLDLLPD       120
     LAAQLAPGGV LGFQVPGNFE APSHLALAEM KRRWAGRVPD DLQKPASHDP AVYLEKLAES       180
     GLEPDVWETT YTYLVPADPD PSVPCGVTEF VRGSALRPAI KALSESDAAD FVSEYDTLAR       240
     AAYPVRELGG HSVQLLPYRR IFAIGRTV                                          268
//

If you have problems or comments...

PBIL Back to PBIL home page