(data stored in ACNUC7421 zone)

EMBL: CP001700.PE12

CP001700.PE12        Location/Qualifiers
FT   CDS             15874..16083
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0012"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0012"
FT                   /db_xref="EnsemblGenomes-Tr:ACU68967"
FT                   /db_xref="UniProtKB/TrEMBL:C7QFM8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU68967.1"
FT                   /translation="MPRFEFKYASDLVVGDWAQIGGKWVEVLGCATDPSGWTRLILDRS
FT                   PLPETVVHQTVDMPWSPMRPAGSA"
     MPRFEFKYAS DLVVGDWAQI GGKWVEVLGC ATDPSGWTRL ILDRSPLPET VVHQTVDMPW        60
     SPMRPAGSA                                                                69
//

If you have problems or comments...

PBIL Back to PBIL home page