(data stored in ACNUC7421 zone)

EMBL: CP001700.PE120

CP001700.PE120       Location/Qualifiers
FT   CDS             124248..124604
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0120"
FT                   /product="Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase"
FT                   /note="PFAM: Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase; KEGG: stp:Strop_4178 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0120"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69075"
FT                   /db_xref="GOA:C7QHD6"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:C7QHD6"
FT                   /inference="protein motif:PFAM:PF00903"
FT                   /protein_id="ACU69075.1"
FT                   /translation="MLAALHHAQVAVPKGAEDVSRAYYVGVLGMTELPKPPVLAARGGC
FT                   WFAAGGLEIHTGVEEPFIPARKAHPAILVTDIDELAAALTAAGHEVAWDQTIPDKRRLH
FT                   TFDPHGNRLEFIQQ"
     MLAALHHAQV AVPKGAEDVS RAYYVGVLGM TELPKPPVLA ARGGCWFAAG GLEIHTGVEE        60
     PFIPARKAHP AILVTDIDEL AAALTAAGHE VAWDQTIPDK RRLHTFDPHG NRLEFIQQ         118
//

If you have problems or comments...

PBIL Back to PBIL home page