(data stored in ACNUC7421 zone)

EMBL: CP001700.PE121

CP001700.PE121       Location/Qualifiers
FT   CDS             complement(124668..125171)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0121"
FT                   /product="protein of unknown function DUF1003"
FT                   /note="PFAM: protein of unknown function DUF1003; KEGG:
FT                   mab:MAB_1523c hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0121"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69076"
FT                   /db_xref="GOA:C7QHD7"
FT                   /db_xref="InterPro:IPR010406"
FT                   /db_xref="UniProtKB/TrEMBL:C7QHD7"
FT                   /inference="protein motif:PFAM:PF06210"
FT                   /protein_id="ACU69076.1"
FT                   /translation="MAREYIPPRLDQPRGRRQVSLKPSFDPDAFGRVSETIARFFGTAR
FT                   YLFIQSLIVVIWIALNILVVTKAIRWDPYPFILLNLAFSTQAAYAAPLILLAQNRQAER
FT                   DKVQIAEDKAREELSFATMEYLTREIASLRMAVGEVATRDYVRGELQSLLKELDERGRD
FT                   YSGE"
     MAREYIPPRL DQPRGRRQVS LKPSFDPDAF GRVSETIARF FGTARYLFIQ SLIVVIWIAL        60
     NILVVTKAIR WDPYPFILLN LAFSTQAAYA APLILLAQNR QAERDKVQIA EDKAREELSF       120
     ATMEYLTREI ASLRMAVGEV ATRDYVRGEL QSLLKELDER GRDYSGE                     167
//

If you have problems or comments...

PBIL Back to PBIL home page