(data stored in ACNUC7421 zone)

EMBL: CP001700.PE122

CP001700.PE122       Location/Qualifiers
FT   CDS             complement(125172..126536)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0122"
FT                   /product="MgtE intracellular region"
FT                   /note="PFAM: MgtE intracellular region; CBS domain
FT                   containing protein; KEGG: ace:Acel_1818 MgtE intracellular
FT                   region"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0122"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69077"
FT                   /db_xref="GOA:C7QHD8"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR006668"
FT                   /db_xref="InterPro:IPR006669"
FT                   /db_xref="InterPro:IPR011033"
FT                   /db_xref="InterPro:IPR027275"
FT                   /db_xref="InterPro:IPR038076"
FT                   /db_xref="UniProtKB/TrEMBL:C7QHD8"
FT                   /inference="protein motif:PFAM:PF03448"
FT                   /protein_id="ACU69077.1"
FT                   /translation="MRALSRVYVSHLAGRSVFDADGEPVGRIRDIVVSMGAGDAAPRVL
FT                   GLVLEMQMHGRRRVFLPIGRVTSIESNQVVSTGLVNMRHFQQRPGETLVLTELLDRRVT
FT                   LKATGETATVRDVAFEPERAGKEMALTKLFVQKAAKTTGLRRRGESLTVDWDAVEGLEV
FT                   SGAQGAAELVAALDKLHAADLAHVMHELSPRRRGEVAAALDDERLADVMEELPEDDQVE
FT                   ILGELESERAADVLEAMDPDDAADLLGELSADEAERLLALMEPQDANPVRRLLSYREDT
FT                   AGGLMNSDPIILLPNATVAEALALVRDEERTPANASLVFVTRAPTETPTGRYLGAVHIQ
FT                   RLLREPPMALVSAAVDVELEPLAPDTMLNEVTAYMATYNLVAVPVVDADDRLLGAVTVD
FT                   DVLDHLLPDDWRLRPPGSHPHDELPPEAREVVELLEGQDAADGAPSPIRTGPGEG"
     MRALSRVYVS HLAGRSVFDA DGEPVGRIRD IVVSMGAGDA APRVLGLVLE MQMHGRRRVF        60
     LPIGRVTSIE SNQVVSTGLV NMRHFQQRPG ETLVLTELLD RRVTLKATGE TATVRDVAFE       120
     PERAGKEMAL TKLFVQKAAK TTGLRRRGES LTVDWDAVEG LEVSGAQGAA ELVAALDKLH       180
     AADLAHVMHE LSPRRRGEVA AALDDERLAD VMEELPEDDQ VEILGELESE RAADVLEAMD       240
     PDDAADLLGE LSADEAERLL ALMEPQDANP VRRLLSYRED TAGGLMNSDP IILLPNATVA       300
     EALALVRDEE RTPANASLVF VTRAPTETPT GRYLGAVHIQ RLLREPPMAL VSAAVDVELE       360
     PLAPDTMLNE VTAYMATYNL VAVPVVDADD RLLGAVTVDD VLDHLLPDDW RLRPPGSHPH       420
     DELPPEAREV VELLEGQDAA DGAPSPIRTG PGEG                                   454
//

If you have problems or comments...

PBIL Back to PBIL home page