(data stored in ACNUC7421 zone)

EMBL: CP001700.PE123

CP001700.PE123       Location/Qualifiers
FT   CDS             126813..127631
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0123"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sma:SAV_3109 lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0123"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69078"
FT                   /db_xref="InterPro:IPR029046"
FT                   /db_xref="UniProtKB/TrEMBL:C7QHD9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU69078.1"
FT                   /translation="MAIAAVAALAGCGSTGTNGVAKKGAGSIVATAEGAVLNATSVHIQ
FT                   GQFTSGNQPVALDLRLEKDKGASGTVTIGTEVLELLRVGPDVYVKGDEAFYRSVLSRLG
FT                   TASAPAPSAPSAPSTSGSASGSSSKSPSAAGSSSAGTSTTGTPSAGQSSSDNSIAVTAM
FT                   QINYLHIGPTDAQYQTFASLTDPRQLLAQIMQGIGSLGKDGQKDIRGTKSIVLSGSKDT
FT                   RVYVAIDGQPFLERVLPPGGGTLDFMDYNTPVTLNPPPPGQVVDIAKIAK"
     MAIAAVAALA GCGSTGTNGV AKKGAGSIVA TAEGAVLNAT SVHIQGQFTS GNQPVALDLR        60
     LEKDKGASGT VTIGTEVLEL LRVGPDVYVK GDEAFYRSVL SRLGTASAPA PSAPSAPSTS       120
     GSASGSSSKS PSAAGSSSAG TSTTGTPSAG QSSSDNSIAV TAMQINYLHI GPTDAQYQTF       180
     ASLTDPRQLL AQIMQGIGSL GKDGQKDIRG TKSIVLSGSK DTRVYVAIDG QPFLERVLPP       240
     GGGTLDFMDY NTPVTLNPPP PGQVVDIAKI AK                                     272
//

If you have problems or comments...

PBIL Back to PBIL home page