(data stored in ACNUC7421 zone)

EMBL: CP001700.PE124

CP001700.PE124       Location/Qualifiers
FT   CDS             complement(127663..128745)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0124"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0124"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69079"
FT                   /db_xref="GOA:C7QHE0"
FT                   /db_xref="UniProtKB/TrEMBL:C7QHE0"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU69079.1"
FT                   /translation="MTDDELALQRDLDEELNRLQPRPVPTEAVYGRARELRRTRRMWAA
FT                   GVLATAAVVGTSLPILGSMGLRQNAAGGGQAVTVNTPHTDKKGRYVFSGSEEGKRWSTT
FT                   VAPGDCPSSGSFNLNVACNASSGSDPAELSYAAPAGLPTTYAIYFRSDIARIDMTLSDG
FT                   GQATLVPGIVRGNRVALVVIPPKIEITRVDVFAADGSPVGFSIPFQADGMAHLAMWYQP
FT                   GQTPTQPEASGTITGITQKGEHASVGVRIGPFGICYTVAQRSTPGAVPITNCRPFSAAA
FT                   SDDVPPNPPDWVALGGLVDDRVDHVDFALTTGTIRVQTVRIGAYSFAVGFADYSFTSLG
FT                   ETAYDASGHVIDREQTPSKS"
     MTDDELALQR DLDEELNRLQ PRPVPTEAVY GRARELRRTR RMWAAGVLAT AAVVGTSLPI        60
     LGSMGLRQNA AGGGQAVTVN TPHTDKKGRY VFSGSEEGKR WSTTVAPGDC PSSGSFNLNV       120
     ACNASSGSDP AELSYAAPAG LPTTYAIYFR SDIARIDMTL SDGGQATLVP GIVRGNRVAL       180
     VVIPPKIEIT RVDVFAADGS PVGFSIPFQA DGMAHLAMWY QPGQTPTQPE ASGTITGITQ       240
     KGEHASVGVR IGPFGICYTV AQRSTPGAVP ITNCRPFSAA ASDDVPPNPP DWVALGGLVD       300
     DRVDHVDFAL TTGTIRVQTV RIGAYSFAVG FADYSFTSLG ETAYDASGHV IDREQTPSKS       360
//

If you have problems or comments...

PBIL Back to PBIL home page