(data stored in ACNUC7421 zone)

EMBL: CP001700.PE125

CP001700.PE125       Location/Qualifiers
FT   CDS             complement(128742..129254)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0125"
FT                   /product="RNA polymerase, sigma-24 subunit, ECF subfamily"
FT                   /note="TIGRFAM: RNA polymerase sigma-70 factor, sigma-E
FT                   family; RNA polymerase sigma factor, sigma-70 family; PFAM:
FT                   Sigma-70 region 4 type 2; sigma-70 region 2 domain protein;
FT                   sigma-70 region 4 domain protein; KEGG: fre:Franean1_0089
FT                   ECF subfamily RNA polymerase sigma-24 factor"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0125"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69080"
FT                   /db_xref="GOA:C7QHE1"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR014325"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:C7QHE1"
FT                   /inference="protein motif:TFAM:TIGR02983"
FT                   /protein_id="ACU69080.1"
FT                   /translation="MRADEDGHDAEFHAFMVGRWPSLVRFAYGLTGDHGHAEDLAQAAL
FT                   AKALVSWSRVRRADDPDAYVRRILINLNRRRFRRRRVEEHVGGEAPEPAAPDSTDQLDQ
FT                   RATLIPALMELPPGQRAVVILRYWDGLTETQTAAILGCSVGNVRSQASRALARLRTNPR
FT                   LHDGSAS"
     MRADEDGHDA EFHAFMVGRW PSLVRFAYGL TGDHGHAEDL AQAALAKALV SWSRVRRADD        60
     PDAYVRRILI NLNRRRFRRR RVEEHVGGEA PEPAAPDSTD QLDQRATLIP ALMELPPGQR       120
     AVVILRYWDG LTETQTAAIL GCSVGNVRSQ ASRALARLRT NPRLHDGSAS                  170
//

If you have problems or comments...

PBIL Back to PBIL home page