(data stored in ACNUC7421 zone)

EMBL: CP001700.PE126

CP001700.PE126       Location/Qualifiers
FT   CDS             complement(129322..130161)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0126"
FT                   /product="type I phosphodiesterase/nucleotide
FT                   pyrophosphatase"
FT                   /note="PFAM: type I phosphodiesterase/nucleotide
FT                   pyrophosphatase; KEGG: aau:AAur_0159 type I
FT                   phosphodiesterase / nucleotide pyrophosphatase family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0126"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69081"
FT                   /db_xref="GOA:C7QHE2"
FT                   /db_xref="InterPro:IPR002591"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="UniProtKB/TrEMBL:C7QHE2"
FT                   /inference="protein motif:PFAM:PF01663"
FT                   /protein_id="ACU69081.1"
FT                   /translation="MSTSRVLVIGIDGTRLDFLDAEPTPNIDRVAGEGFLATVWVEDGT
FT                   PTVSGPCWATAVTGTTIERHHIGSNDFAGHRLAEHPDFLTVLTRDFGLHTYLAVGAWPP
FT                   LATPADHGPMFAAPSRLTFATFGQSAQACDQGDETITRDAERILATENIHAAFVYLGAN
FT                   DATAHDQGCGDLYRTAIRRTDARTGRLLAAVASRPDRATENWTFILLTDHGHLPEGGHG
FT                   GTTTPERTAWIAACGPGIQAGADYGTLRHVDVAAHVYAALGVEPEIVLDGKAFQTMH"
     MSTSRVLVIG IDGTRLDFLD AEPTPNIDRV AGEGFLATVW VEDGTPTVSG PCWATAVTGT        60
     TIERHHIGSN DFAGHRLAEH PDFLTVLTRD FGLHTYLAVG AWPPLATPAD HGPMFAAPSR       120
     LTFATFGQSA QACDQGDETI TRDAERILAT ENIHAAFVYL GANDATAHDQ GCGDLYRTAI       180
     RRTDARTGRL LAAVASRPDR ATENWTFILL TDHGHLPEGG HGGTTTPERT AWIAACGPGI       240
     QAGADYGTLR HVDVAAHVYA ALGVEPEIVL DGKAFQTMH                              279
//

If you have problems or comments...

PBIL Back to PBIL home page