(data stored in ACNUC7421 zone)

EMBL: CP001700.PE127

CP001700.PE127       Location/Qualifiers
FT   CDS             complement(130199..131221)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0127"
FT                   /product="D-isomer specific 2-hydroxyacid dehydrogenase
FT                   NAD-binding"
FT                   /note="PFAM: D-isomer specific 2-hydroxyacid dehydrogenase
FT                   NAD-binding; KEGG: sma:SAV_2089 2-hydroxyacid
FT                   dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0127"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69082"
FT                   /db_xref="GOA:C7QHE3"
FT                   /db_xref="InterPro:IPR006140"
FT                   /db_xref="InterPro:IPR029753"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C7QHE3"
FT                   /inference="protein motif:PFAM:PF02826"
FT                   /protein_id="ACU69082.1"
FT                   /translation="MAGRAAALLAMRPDVAQAAFPAALRTRLDAVVEIDHGLVVTDFAE
FT                   PRARWALAGAEVLLTGWGCPPLDAEALDAAPNLRAVIHAAGSVKHHLSPDFWTRGILAS
FT                   SAADANAYPVAQFTLSVILLAGKRMFTMARHYAEGTYKPPSTSQRFGNVGRTVGVVGAS
FT                   RIGRLVLPMLAREGFEVLLADPTLSAAEAAALMPAPWAVELVELDELLRRSDVVTLHAP
FT                   SLPETHHLLDDRRLGLMRDGSVLVNTARGALIDTEALVRCCAAGRIDAFLDVTDPDEPL
FT                   PPGHPLFLLPNVVVTPHLAGAMGSEIALLGAYAVADVERYAAGLPLLGGVHQDDLARIA
FT                   "
     MAGRAAALLA MRPDVAQAAF PAALRTRLDA VVEIDHGLVV TDFAEPRARW ALAGAEVLLT        60
     GWGCPPLDAE ALDAAPNLRA VIHAAGSVKH HLSPDFWTRG ILASSAADAN AYPVAQFTLS       120
     VILLAGKRMF TMARHYAEGT YKPPSTSQRF GNVGRTVGVV GASRIGRLVL PMLAREGFEV       180
     LLADPTLSAA EAAALMPAPW AVELVELDEL LRRSDVVTLH APSLPETHHL LDDRRLGLMR       240
     DGSVLVNTAR GALIDTEALV RCCAAGRIDA FLDVTDPDEP LPPGHPLFLL PNVVVTPHLA       300
     GAMGSEIALL GAYAVADVER YAAGLPLLGG VHQDDLARIA                             340
//

If you have problems or comments...

PBIL Back to PBIL home page