(data stored in ACNUC7421 zone)

EMBL: CP001700.PE128

CP001700.PE128       Location/Qualifiers
FT   CDS             131505..132464
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0128"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: aau:AAur_1453 putative
FT                   transmembrane lipoprotein LplB"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0128"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69083"
FT                   /db_xref="GOA:C7QHE4"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C7QHE4"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ACU69083.1"
FT                   /translation="MAATAAAAAAPAAAKPRAGTRWARFRRDKVLLLMMLPGVLYFGVF
FT                   QYLAQLGNIIAFKDYVPFVGIKDSAWVGFQQFSTLFADPDFWHAVRNTFELALVQLMFF
FT                   FPVPLALAMFLFSLTRNWVRKLVVSFVYLPHFISWVVVVGLFVQVLGPSGMVNSFLTHD
FT                   SHHVVVNVFRDPAWFKPMMLIELVWKDCGWGTIIFLAALYQVDDSLYEAVSLDGAGWAR
FT                   RTWHVTLPSIRPVLVLLLILRVGDILSVGFDQVMQQRDTFTPAAAEVIDTYVYNHGVGS
FT                   GQFSVAAVAGLLKGVVAMVLVIGANKVAHKLGEQGVYQ"
     MAATAAAAAA PAAAKPRAGT RWARFRRDKV LLLMMLPGVL YFGVFQYLAQ LGNIIAFKDY        60
     VPFVGIKDSA WVGFQQFSTL FADPDFWHAV RNTFELALVQ LMFFFPVPLA LAMFLFSLTR       120
     NWVRKLVVSF VYLPHFISWV VVVGLFVQVL GPSGMVNSFL THDSHHVVVN VFRDPAWFKP       180
     MMLIELVWKD CGWGTIIFLA ALYQVDDSLY EAVSLDGAGW ARRTWHVTLP SIRPVLVLLL       240
     ILRVGDILSV GFDQVMQQRD TFTPAAAEVI DTYVYNHGVG SGQFSVAAVA GLLKGVVAMV       300
     LVIGANKVAH KLGEQGVYQ                                                    319
//

If you have problems or comments...

PBIL Back to PBIL home page