(data stored in ACNUC7421 zone)

EMBL: CP001700.PE129

CP001700.PE129       Location/Qualifiers
FT   CDS             132461..133360
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0129"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: aau:AAur_1454 putative
FT                   transmembrane lipoprotein LplC"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0129"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69084"
FT                   /db_xref="GOA:C7QHE5"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C7QHE5"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ACU69084.1"
FT                   /translation="MSAESPNLRPAWMGRPKPAVSALKAAAVVVILALIAVPFWLVLAT
FT                   SVSSDAEVNANGGWSLWPDKLDFSAYTNVFQGGTIGHALWVSVLVTALGTAASLASTTF
FT                   LAYALSRPNVVAGKPILLAVLFTFLFPAGMIPSFLVVTDLHLFDHLAALFVPVMINVFN
FT                   LVVMRGFFQGIPEELYEAARLDGAGDLRTLFRIVLPLSKAIIAVVGLYYAVGYWNDYFR
FT                   AMLYTNGGSLNPLSTVLRGFVIAGNNPNAEAGVDITGIAPMKAISALVVIAIVPIAAAF
FT                   PFLQRYFTKGVMTGAVKS"
     MSAESPNLRP AWMGRPKPAV SALKAAAVVV ILALIAVPFW LVLATSVSSD AEVNANGGWS        60
     LWPDKLDFSA YTNVFQGGTI GHALWVSVLV TALGTAASLA STTFLAYALS RPNVVAGKPI       120
     LLAVLFTFLF PAGMIPSFLV VTDLHLFDHL AALFVPVMIN VFNLVVMRGF FQGIPEELYE       180
     AARLDGAGDL RTLFRIVLPL SKAIIAVVGL YYAVGYWNDY FRAMLYTNGG SLNPLSTVLR       240
     GFVIAGNNPN AEAGVDITGI APMKAISALV VIAIVPIAAA FPFLQRYFTK GVMTGAVKS        299
//

If you have problems or comments...

PBIL Back to PBIL home page