(data stored in ACNUC7421 zone)

EMBL: CP001700.PE13

CP001700.PE13        Location/Qualifiers
FT   CDS             16080..16481
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0013"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0013"
FT                   /db_xref="EnsemblGenomes-Tr:ACU68968"
FT                   /db_xref="UniProtKB/TrEMBL:C7QFM9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU68968.1"
FT                   /translation="MRRPEDIGAFLAEHSDGRVIGQMPAMFGIAVTPAEAEFQRRLLAA
FT                   GHTGSYLALLGLAATLTFDAGEYFHTGEQNRRDLSEWHGYHRGLQTALACLVMHETGSN
FT                   PRQAALMVAEHTETLIRCRWANRPAKGGG"
     MRRPEDIGAF LAEHSDGRVI GQMPAMFGIA VTPAEAEFQR RLLAAGHTGS YLALLGLAAT        60
     LTFDAGEYFH TGEQNRRDLS EWHGYHRGLQ TALACLVMHE TGSNPRQAAL MVAEHTETLI       120
     RCRWANRPAK GGG                                                          133
//

If you have problems or comments...

PBIL Back to PBIL home page